| 15 | | - | Be it enacted by the General Assembly of the state of Missouri, as follows: |
|---|
| 16 | | - | Section A. Sections 197.400, 197.445, 327.312, 327.313, 327.314, 327.331, 334.100, |
|---|
| 17 | | - | 2 334.530, 334.655, 338.055, 345.015, and 345.050, RSMo, are repealed and seventeen new |
|---|
| 18 | | - | 3 sections enacted in lieu thereof, to be known as sections 197.400, 197.445, 324.005, 327.312, |
|---|
| 19 | | - | 4 327.313, 327.314, 327.331, 332.325, 334.100, 334.530, 334.655, 338.055, 345.015, 345.022, |
|---|
| 20 | | - | 5 345.050, 345.052, and 345.085, to read as follows: |
|---|
| 21 | | - | 197.400. As used in sections 197.400 to 197.475, unless the context otherwise |
|---|
| 22 | | - | 2 requires, the following terms mean: |
|---|
| 23 | | - | 3 (1) "Council", the home health services advisory council created by sections 197.400 |
|---|
| 24 | | - | 4 to 197.475; |
|---|
| 25 | | - | 5 (2) "Department", the department of health and senior services; |
|---|
| 26 | | - | 6 (3) "Home health agency", a public agency or private organization or a subdivision or |
|---|
| 27 | | - | 7 subunit of an agency or organization that provides two or more home health services at the |
|---|
| 28 | | - | 8 residence of a patient according to a[physician's] written[and signed] plan of treatment |
|---|
| 29 | | - | 9signed by a physician, nurse practitioner, clinical nurse specialist, or physician assistant; |
|---|
| 30 | | - | EXPLANATION — Matter enclosed in bold-faced brackets[thus] in the above bill is not enacted and is |
|---|
| 31 | | - | intended to be omitted from the law. Matter inbold-facetype in the above bill is proposed language. 10 (4)"Homehealthservices",anyofthefollowingitemsandservicesprovidedatthe |
|---|
| 32 | | - | 11residenceofthepatientonapart-timeorintermittentbasis:nursing,physicaltherapy,speech |
|---|
| 33 | | - | 12therapy,occupationaltherapy,homehealthaid,ormedicalsocialservice; |
|---|
| 34 | | - | 13 (5)"Nursepractitioner,clinicalnursespecialist",apersonrecognizedbythe |
|---|
| 35 | | - | 14stateboardofnursingpursuanttotheprovisionsofchapter335topracticeinthisstate |
|---|
| 36 | | - | 15asanursepractitionerorclinicalnursespecialist; |
|---|
| 37 | | - | 16 (6)"Part-timeorintermittentbasis",theprovidingofhomehealthservicesinan |
|---|
| 38 | | - | 17interruptedintervalsequenceontheaverageofnottoexceedthreehoursinanytwenty-four- |
|---|
| 39 | | - | 18hourperiod; |
|---|
| 40 | | - | 19 [(6)](7)"Patient'sresidence",theactualplaceofresidenceofthepersonreceiving |
|---|
| 41 | | - | 20homehealthservices,includinginstitutionalresidencesaswellasindividualdwellingunits; |
|---|
| 42 | | - | 21 [(7)](8)"Physician",apersonlicensedbythestateboardofregistrationforthe |
|---|
| 43 | | - | 22healingartspursuanttotheprovisionsofchapter334topracticeinthisstateasaphysician |
|---|
| 44 | | - | 23andsurgeon; |
|---|
| 45 | | - | 24 (9)"Physicianassistant",apersonlicensedbythestateboardofregistrationfor |
|---|
| 46 | | - | 25thehealingartspursuanttotheprovisionsofchapter334topracticeinthisstateasa |
|---|
| 47 | | - | 26physicianassistant; |
|---|
| 48 | | - | 27 [(8)](10)"Planoftreatment",aplanreviewedandsignedasoftenas[medically] |
|---|
| 49 | | - | 28necessarybyaphysician[or],podiatrist,nursepractitioner,clinicalnursespecialist,ora |
|---|
| 50 | | - | 29physicianassistant,nottoexceedsixtydaysinduration,andreviewedbyaphysicianat |
|---|
| 51 | | - | 30leastonceeverysixmonths,prescribingitemsandservicesforanindividualpatient's |
|---|
| 52 | | - | 31condition; |
|---|
| 53 | | - | 32 [(9)](11)"Podiatrist",apersonlicensedbythestateboardofpodiatrypursuanttothe |
|---|
| 54 | | - | 33provisionsofchapter330topracticeinthisstateasapodiatrist; |
|---|
| 55 | | - | 34 [(10)] (12)"Subunit"or"subdivision",anyorganizationalunitofalarger |
|---|
| 56 | | - | 35organizationwhichcanbeclearlydefinedasaseparateentitywithinthelargerstructure, |
|---|
| 57 | | - | 36whichcanmeetalloftherequirementsofsections197.400to197.475independentofthe |
|---|
| 58 | | - | 37largerorganization,whichcanbeheldaccountableforthecareofpatientsitisserving,and |
|---|
| 59 | | - | 38whichprovidestoallpatientscareandservicesmeetingthestandardsandrequirementsof |
|---|
| 60 | | - | 39sections197.400to197.475. |
|---|
| 61 | | - | 197.445.1.Thedepartmentmayadoptreasonablerulesandstandardsnecessaryto |
|---|
| 62 | | - | 2carryouttheprovisionsofsections197.400to197.477.Therulesandstandardsadopted |
|---|
| 63 | | - | 3shallnotbelessthanthestandardsestablishedbythefederalgovernmentforhomehealth |
|---|
| 64 | | - | 4agenciesunderTitleXVIIIoftheFederalSocialSecurityAct.Thereasonablerulesand |
|---|
| 65 | | - | 5standardsshallbeinitiallypromulgatedwithinoneyearofSeptember28,1983. |
|---|
| 66 | | - | 6 2.Therulesandstandardsadoptedbythedepartmentpursuanttotheprovisionsof |
|---|
| 67 | | - | 7sections197.400to197.477shallapplytoallhealthservicescoveredbysections197.400to |
|---|
| 68 | | - | CCS#2SSHB2149 2 8197.477renderedtoanypatientbeingservedbyahomehealthagencyregardlessofsourceof |
|---|
| 69 | | - | 9paymentfortheservice,patient'scondition,orplaceofresidence,atwhichthehomehealth |
|---|
| 70 | | - | 10servicesareorderedbythephysician[or],podiatrist, nursepractitioner,clinicalnurse |
|---|
| 71 | | - | 11specialist,orphysicianassistant. Noruleorportionofarulepromulgatedpursuanttothe |
|---|
| 72 | | - | 12authorityofsections197.400to197.477shallbecomeeffectiveunlessithasbeen |
|---|
| 73 | | - | 13promulgatedpursuanttotheprovisionsofsection536.024. |
|---|
| 74 | | - | 324.005.1.Notwithstandinganyrequirementsforlicensureforallprofessional |
|---|
| 75 | | - | 2boards,commissions,committees,andofficeswithinthedivisionofprofessional |
|---|
| 76 | | - | 3registrationtothecontrary,aprofessionalwhohasacurrentlicensetopracticefrom |
|---|
| 77 | | - | 4anotherstate,commonwealth,territory,ortheDistrictofColumbiashallbeexempt |
|---|
| 78 | | - | 5fromthelicensurerequirementsofhisorherrespectivelicensureboardinthisstateif: |
|---|
| 79 | | - | 6 (1)TheprofessionalisanactivedutyorreservememberoftheArmedForcesof |
|---|
| 80 | | - | 7theUnitedStates,amemberoftheNationalGuard,acivilianemployeeoftheUnited |
|---|
| 81 | | - | 8StatesDepartmentofDefense,anauthorizedservicescontractorunder10U.S.C. |
|---|
| 82 | | - | 9Section1091,oraprofessionalotherwiseauthorizedbytheUnitedStatesDepartmentof |
|---|
| 83 | | - | 10Defense; |
|---|
| 84 | | - | 11 (2)Theprofessionalpracticesthesameoccupationorprofessionatthesame |
|---|
| 85 | | - | 12practicelevelforwhichheorsheholdsacurrentlicense;and |
|---|
| 86 | | - | 13 (3)Theprofessionalisengagedinthepracticeofaprofessionalthrougha |
|---|
| 87 | | - | 14partnershipwiththefederalInnovativeReadinessTrainingprogramwithintheUnited |
|---|
| 88 | | - | 15StatesDepartmentofDefense. |
|---|
| 89 | | - | 16 2.Theexemptionprovidedinthissectionshallnotpermitaprofessionalto |
|---|
| 90 | | - | 17engageinpracticeexceptaspartofthefederalInnovativeReadinessTrainingprogram |
|---|
| 91 | | - | 18withintheUnitedStatesDepartmentofDefense.Theexemptionshallonlyapplywhile: |
|---|
| 92 | | - | 19 (1)Theprofessional'spracticeisrequiredbytheprogrampursuanttomilitary |
|---|
| 93 | | - | 20orders;and |
|---|
| 94 | | - | 21 (2)Theservicesprovidedbytheprofessionalarewithinthescopeofpracticefor |
|---|
| 95 | | - | 22theindividual'srespectiveprofessioninthisstate. |
|---|
| 96 | | - | 327.312.1.PriortoJanuary1,2024,anypersonmayapplytotheboardfor |
|---|
| 97 | | - | 2enrollmentasalandsurveyor-in-trainingwhoisahighschoolgraduate,orwhoholdsa |
|---|
| 98 | | - | 3Missouricertificateofhighschoolequivalence(GED),andeither: |
|---|
| 99 | | - | 4 (1)Hasgraduatedandreceivedabaccalaureatedegreeinanapprovedcurriculumas |
|---|
| 100 | | - | 5definedbyboardregulationwhichshallincludeatleasttwelvesemesterhoursofapproved |
|---|
| 101 | | - | 6surveyingcourseworkasdefinedbyboardregulationofwhichatleasttwosemesterhours |
|---|
| 102 | | - | 7shallbeinthelegalaspectsofboundarysurveying;or |
|---|
| 103 | | - | 8 (2)Haspassedatleastsixtyhoursofcollegecreditwhichshallincludecreditforat |
|---|
| 104 | | - | 9leasttwentysemesterhoursofapprovedsurveyingcourseworkasdefinedbyboard |
|---|
| 105 | | - | CCS#2SSHB2149 3 10regulationofwhichatleasttwosemesterhoursshallbeinlegalaspectsofboundary |
|---|
| 106 | | - | 11surveyingandpresentevidencesatisfactorytotheboardthatinadditiontheretosuchperson |
|---|
| 107 | | - | 12hasatleastoneyearofcombinedprofessionalofficeandfieldexperienceinlandsurveying |
|---|
| 108 | | - | 13projectsundertheimmediatepersonalsupervisionofaprofessionallandsurveyor;or |
|---|
| 109 | | - | 14 (3)Haspassedatleasttwelvesemesterhoursofapprovedsurveyingcourseworkas |
|---|
| 110 | | - | 15definedbyboardregulationofwhichatleasttwosemesterhoursshallbeinlegalaspectsof |
|---|
| 111 | | - | 16landsurveyingandinadditiontheretohasatleasttwoyearsofcombinedprofessionaloffice |
|---|
| 112 | | - | 17andfieldexperienceinlandsurveyingprojectsundertheimmediatepersonalsupervisionofa |
|---|
| 113 | | - | 18professionallandsurveyor.Pursuanttothisprovision,notmorethanoneyearofsatisfactory |
|---|
| 114 | | - | 19postsecondaryeducationworkshallcountasequivalentyearsofsatisfactorylandsurveying |
|---|
| 115 | | - | 20workasaforementioned. |
|---|
| 116 | | - | 21 2.Theboardshallissueacertificateofcompletiontoeachapplicantwhosatisfiesthe |
|---|
| 117 | | - | 22requirementsoftheaforementionedlandsurveyor-in-trainingprogramandpassessuch |
|---|
| 118 | | - | 23examinationorexaminationsasshallberequiredbytheboard. |
|---|
| 119 | | - | 24 3.BeginningJanuary1,2024,anypersonmayapplytotheboardforenrollment |
|---|
| 120 | | - | 25asalandsurveyor-internwhoisahighschoolgraduate,orwhoholdsacertificateof |
|---|
| 121 | | - | 26highschoolequivalence(GED),andhaspassedanyexaminationrequiredbytheboard |
|---|
| 122 | | - | 27pursuanttosection327.331. |
|---|
| 123 | | - | 327.313.Applicationsforenrollmentasaland[surveyor-in-training] surveyor- |
|---|
| 124 | | - | 2internshallbetypewrittenonprescribedformsfurnishedtotheapplicant.Theapplication |
|---|
| 125 | | - | 3shallcontainapplicant'sstatementsshowingtheapplicant'seducation,experience,andsuch |
|---|
| 126 | | - | 4otherpertinentinformationastheboardmayrequire.Eachapplicationshallcontaina |
|---|
| 127 | | - | 5statementthatitismadeunderoathoraffirmationandthattherepresentationsaretrueand |
|---|
| 128 | | - | 6correcttothebestknowledgeandbeliefoftheapplicant,subjecttothepenaltiesofmakinga |
|---|
| 129 | | - | 7falseaffidavitordeclarationandshallbeaccompaniedbytherequiredfee. |
|---|
| 130 | | - | 327.314.1.PriortoJanuary1,2024,anypersonmayapplytotheboardfor |
|---|
| 131 | | - | 2licensureasaprofessionallandsurveyorwhohasbeenenrolledasalandsurveyor-in-training |
|---|
| 132 | | - | 3andhaspresentedevidencetothesatisfactionoftheboardthatsaidpersonhasacquiredat |
|---|
| 133 | | - | 4leastfouryearsofsatisfactoryprofessionalfieldandofficeexperienceinlandsurveyingfrom |
|---|
| 134 | | - | 5thedateofenrollmentasalandsurveyor-in-training.Thisexperienceshallhavebeenunder |
|---|
| 135 | | - | 6theimmediatepersonalsupervisionofaprofessionallandsurveyor. |
|---|
| 136 | | - | 7 2.BeginningJanuary1,2024,anypersonmayapplytotheboardforlicensure |
|---|
| 137 | | - | 8whopresentsevidencesatisfactorytotheboardthattheapplicanthasmetthe |
|---|
| 138 | | - | 9requirementsasprovidedinthissubsection: |
|---|
| 139 | | - | 10 (1)Anapplicantshallbeahighschoolgraduateorholdacertificateofhigh |
|---|
| 140 | | - | 11schoolequivalence(GED),andeither: |
|---|
| 141 | | - | CCS#2SSHB2149 4 12 (a)Hasgraduatedandreceivedabaccalaureatedegreeinanapproved |
|---|
| 142 | | - | 13curriculum,asdefinedbytheboard,whichshallincludeatleastfifteensemesterhours |
|---|
| 143 | | - | 14ofapprovedsurveyingcoursework,asdefinedbytheboard,ofwhichatleastsix |
|---|
| 144 | | - | 15semesterhoursshallbeinthelegalaspectsofboundarysurveying;or |
|---|
| 145 | | - | 16 (b)Haspassedatleastsixtyhoursofcollegecreditwhichshallincludeatleast |
|---|
| 146 | | - | 17fifteensemesterhoursofapprovedsurveyingcoursework,asdefinedbytheboard,of |
|---|
| 147 | | - | 18whichatleastsixsemesterhoursshallbeinlegalaspectsofboundarysurveying;or |
|---|
| 148 | | - | 19 (c)Haspassedatleastfifteensemesterhoursofapprovedsurveyingcoursework, |
|---|
| 149 | | - | 20asdefinedbytheboard,ofwhichatleastsixsemesterhoursshallbeinlegalaspectsof |
|---|
| 150 | | - | 21landsurveying; |
|---|
| 151 | | - | 22 (d)Anapplicantmeetingtherequirementsofparagraph(a)ofthissubdivision |
|---|
| 152 | | - | 23shallhaveacquiredatleastfouryearsofsatisfactoryfieldandofficeexperienceinland |
|---|
| 153 | | - | 24surveyingundertheimmediatepersonalsupervisionofaprofessionallandsurveyor; |
|---|
| 154 | | - | 25 (e)Anapplicantmeetingtherequirementsofparagraph(b)ofthissubdivision |
|---|
| 155 | | - | 26shallhaveacquiredatleastfiveyearsofsatisfactoryfieldandofficeexperienceinland |
|---|
| 156 | | - | 27surveyingundertheimmediatepersonalsupervisionofaprofessionallandsurveyor; |
|---|
| 157 | | - | 28 (f)Anapplicantmeetingtherequirementsofparagraph(c)ofthissubdivision |
|---|
| 158 | | - | 29shallhaveacquiredatleastsixyearsofsatisfactoryfieldandofficeexperienceinland |
|---|
| 159 | | - | 30surveyingundertheimmediatepersonalsupervisionofaprofessionallandsurveyor. |
|---|
| 160 | | - | 31Pursuanttothisprovision,uptooneyearofpost-secondaryeducation,approvedbythe |
|---|
| 161 | | - | 32board,maycountasequivalentworkexperience; |
|---|
| 162 | | - | 33 (2)Anapplicantshallpassanyexaminationsrequiredbytheboardpursuantto |
|---|
| 163 | | - | 34section327.331; |
|---|
| 164 | | - | 35 (3)Anypersonenrolledasalandsurveyor-in-trainingpriortoJanuary1,2024, |
|---|
| 165 | | - | 36shallonlyberequiredtomeettherequirementsinplacepursuanttotheirenrollment. |
|---|
| 166 | | - | 327.331.1.Afterithasbeendeterminedthatanapplicantpossessesthe |
|---|
| 167 | | - | 2qualificationsentitlingtheapplicanttobeexamined,eachapplicantforexaminationand |
|---|
| 168 | | - | 3enrollmentasalandsurveyor-in-trainingandforexaminationandlicensureasaprofessional |
|---|
| 169 | | - | 4landsurveyorinMissourishallappearbeforetheboardoritsrepresentativesforexamination |
|---|
| 170 | | - | 5atthetimeandplacespecified. |
|---|
| 171 | | - | 6 2.Theexaminationorexaminationsshallbeofsuchform,contentanddurationas |
|---|
| 172 | | - | 7shallbedeterminedbytheboardtothoroughlytestthequalificationsofeachapplicantto |
|---|
| 173 | | - | 8becomeenrolledasaland[surveyor-in-training] surveyor-internortobecomelicensedasa |
|---|
| 174 | | - | 9professionallandsurveyorinMissouri. |
|---|
| 175 | | - | 10 3.Anyapplicanttobeeligibleforenrollmentorforlicensemustmakeagradeonthe |
|---|
| 176 | | - | 11applicableexaminationofatleastseventypercent. |
|---|
| 177 | | - | CCS#2SSHB2149 5 12 4.Anypersonwhopassestheexaminationhereinabovespecifiedshallbeentitledto |
|---|
| 178 | | - | 13beenrolledasaland[surveyor-in-training] surveyor-internorlicensedasaprofessionalland |
|---|
| 179 | | - | 14surveyor,asthecasemaybe,inMissouriandshallreceiveacertificateofenrollmentora |
|---|
| 180 | | - | 15license,asthecasemaybe. |
|---|
| 181 | | - | 332.325.1.TheMissouridentalboardmaycollaboratewiththedepartmentof |
|---|
| 182 | | - | 2healthandseniorservicesandtheofficeofdentalhealthwithinthedepartmentofhealth |
|---|
| 183 | | - | 3andseniorservicestoapprovepilotprojectsdesignedtoexaminenewmethodsof |
|---|
| 184 | | - | 4extendingcaretomedicallyunderservedpopulations,asdefinedin42U.S.C.Section |
|---|
| 185 | | - | 5300e-1(7).Thesepilotprojectsmayemploytechniquesorapproachestocarethatmay |
|---|
| 186 | | - | 6necessitateawaiveroftherequirementsofthischapterandregulationspromulgated |
|---|
| 187 | | - | 7thereunder;provided: |
|---|
| 188 | | - | 8 (1)Theprojectplanhasaclearlystatedobjectiveofservingaspecific |
|---|
| 189 | | - | 9underservedpopulationthatwarrants,intheopinionofamajorityoftheboard, |
|---|
| 190 | | - | 10grantingapprovalforapilotproject; |
|---|
| 191 | | - | 11 (2)Theprojecthasafinitestartdateandterminationdate; |
|---|
| 192 | | - | 12 (3)Theprojectclearlydefinesthenewtechniquesorapproachesitintendsto |
|---|
| 193 | | - | 13examinetodetermineifitresultsinanimprovementinaccessorqualityofcare; |
|---|
| 194 | | - | 14 (4)Theprojectplanidentifiesspecificandlimitedlocationsandpopulationsto |
|---|
| 195 | | - | 15participateinthepilotproject; |
|---|
| 196 | | - | 16 (5)Theprojectplanclearlyestablishesminimumguidelinesandstandardsfor |
|---|
| 197 | | - | 17thepilotproject,including,butnotlimitedto,provisionsforprotectingsafetyof |
|---|
| 198 | | - | 18participatingpatients; |
|---|
| 199 | | - | 19 (6)Theprojectplanclearlydefinesthemeasurementcriteriaitwilluseto |
|---|
| 200 | | - | 20evaluatetheoutcomesofthepilotprojectonaccessandqualityofcare;and |
|---|
| 201 | | - | 21 (7)Theprojectplanidentifiesreportingintervalstocommunicateinterimand |
|---|
| 202 | | - | 22finaloutcomestotheboard. |
|---|
| 203 | | - | 23 2.Theboardmaypromulgaterulesandregulationstoimplementtheprovisions |
|---|
| 204 | | - | 24ofthissection.Anyruleorportionofarule,asthattermisdefinedinsection536.010, |
|---|
| 205 | | - | 25thatiscreatedundertheauthoritydelegatedinthissectionshallbecomeeffectiveonlyif |
|---|
| 206 | | - | 26itcomplieswithandissubjecttoalloftheprovisionsofchapter536and,ifapplicable, |
|---|
| 207 | | - | 27section536.028.Thissectionandchapter536arenonseverableandifanyofthepowers |
|---|
| 208 | | - | 28vestedwiththegeneralassemblypursuanttochapter536toreview,todelaythe |
|---|
| 209 | | - | 29effectivedate,ortodisapproveandannularulearesubsequentlyheldunconstitutional, |
|---|
| 210 | | - | 30thenthegrantofrulemakingauthorityandanyruleproposedoradoptedafterAugust |
|---|
| 211 | | - | 3128,2022,shallbeinvalidandvoid. |
|---|
| 212 | | - | 32 3.TheprovisionsofthissectionshallexpireonAugust28,2026.Theboardshall |
|---|
| 213 | | - | 33provideafinalreportonapprovedprojectsandrelateddataorfindingstothegeneral |
|---|
| 214 | | - | CCS#2SSHB2149 6 34assemblyonorbeforeDecember31,2025.Thename,location,approvaldates,and |
|---|
| 215 | | - | 35generaldescriptionofanapprovedpilotprojectshallbedeemedapublicrecord |
|---|
| 216 | | - | 36pursuanttochapter610. |
|---|
| 217 | | - | 334.100.1.Theboardmayrefusetoissueorrenewanycertificateofregistrationor |
|---|
| 218 | | - | 2authority,permitorlicenserequiredpursuanttothischapterforoneoranycombinationof |
|---|
| 219 | | - | 3causesstatedinsubsection2ofthissection.Theboardshallnotifytheapplicantinwritingof |
|---|
| 220 | | - | 4thereasonsfortherefusalandshalladvisetheapplicantoftheapplicant'srighttofilea |
|---|
| 221 | | - | 5complaintwiththeadministrativehearingcommissionasprovidedbychapter621.Asan |
|---|
| 222 | | - | 6alternativetoarefusaltoissueorrenewanycertificate,registrationorauthority,theboard |
|---|
| 223 | | - | 7may,atitsdiscretion,issuealicensewhichissubjecttoprobation,restrictionorlimitationto |
|---|
| 224 | | - | 8anapplicantforlicensureforanyoneoranycombinationofcausesstatedinsubsection2of |
|---|
| 225 | | - | 9thissection.Theboard'sorderofprobation,limitationorrestrictionshallcontainastatement |
|---|
| 226 | | - | 10ofthedisciplineimposed,thebasistherefor,thedatesuchactionshallbecomeeffective,anda |
|---|
| 227 | | - | 11statementthattheapplicanthasthirtydaystorequestinwritingahearingbeforethe |
|---|
| 228 | | - | 12administrativehearingcommission.Iftheboardissuesaprobationary,limitedorrestricted |
|---|
| 229 | | - | 13licensetoanapplicantforlicensure,eitherpartymayfileawrittenpetitionwiththe |
|---|
| 230 | | - | 14administrativehearingcommissionwithinthirtydaysoftheeffectivedateoftheprobationary, |
|---|
| 231 | | - | 15limitedorrestrictedlicenseseekingreviewoftheboard'sdetermination.Ifnowrittenrequest |
|---|
| 232 | | - | 16forahearingisreceivedbytheadministrativehearingcommissionwithinthethirty-day |
|---|
| 233 | | - | 17period,therighttoseekreviewoftheboard'sdecisionshallbeconsideredaswaived. |
|---|
| 234 | | - | 18 2.Theboardmaycauseacomplainttobefiledwiththeadministrativehearing |
|---|
| 235 | | - | 19commissionasprovidedbychapter621againstanyholderofanycertificateofregistrationor |
|---|
| 236 | | - | 20authority,permitorlicenserequiredbythischapteroranypersonwhohasfailedtorenewor |
|---|
| 237 | | - | 21hassurrenderedtheperson'scertificateofregistrationorauthority,permitorlicenseforany |
|---|
| 238 | | - | 22oneoranycombinationofthefollowingcauses: |
|---|
| 239 | | - | 23 (1)Useofanycontrolledsubstance,asdefinedinchapter195,oralcoholicbeverage |
|---|
| 240 | | - | 24toanextentthatsuchuseimpairsaperson'sabilitytoperformtheworkofanyprofession |
|---|
| 241 | | - | 25licensedorregulatedbythischapter; |
|---|
| 242 | | - | 26 (2)Thepersonhasbeenfinallyadjudicatedandfoundguilty,orenteredapleaof |
|---|
| 243 | | - | 27guiltyornolocontendere,inacriminalprosecutionunderthelawsofanystateorofthe |
|---|
| 244 | | - | 28UnitedStates,foranyoffensereasonablyrelatedtothequalifications,functionsordutiesof |
|---|
| 245 | | - | 29anyprofessionlicensedorregulatedpursuanttothischapter,foranyoffenseinvolvingfraud, |
|---|
| 246 | | - | 30dishonestyoranactofviolence,orforanyoffenseinvolvingmoralturpitude,whetherornot |
|---|
| 247 | | - | 31sentenceisimposed; |
|---|
| 248 | | - | 32 (3)Useoffraud,deception,misrepresentationorbriberyinsecuringanycertificateof |
|---|
| 249 | | - | 33registrationorauthority,permitorlicenseissuedpursuanttothischapterorinobtaining |
|---|
| 250 | | - | 34permissiontotakeanyexaminationgivenorrequiredpursuanttothischapter; |
|---|
| 251 | | - | CCS#2SSHB2149 7 35 (4)Misconduct,fraud,misrepresentation,dishonesty,unethicalconductor |
|---|
| 252 | | - | 36unprofessionalconductintheperformanceofthefunctionsordutiesofanyprofession |
|---|
| 253 | | - | 37licensedorregulatedbythischapter,including,butnotlimitedto,thefollowing: |
|---|
| 254 | | - | 38 (a)Obtainingorattemptingtoobtainanyfee,charge,tuitionorothercompensation |
|---|
| 255 | | - | 39byfraud,deceptionormisrepresentation;willfullyandcontinuallyoverchargingor |
|---|
| 256 | | - | 40overtreatingpatients;orchargingforvisitstothephysician'sofficewhichdidnotoccur |
|---|
| 257 | | - | 41unlesstheserviceswerecontractedforinadvance,orforserviceswhichwerenotrenderedor |
|---|
| 258 | | - | 42documentedinthepatient'srecords; |
|---|
| 259 | | - | 43 (b)Attempting,directlyorindirectly,bywayofintimidation,coercionordeception, |
|---|
| 260 | | - | 44toobtainorretainapatientordiscouragetheuseofasecondopinionorconsultation; |
|---|
| 261 | | - | 45 (c)Willfullyandcontinuallyperforminginappropriateorunnecessarytreatment, |
|---|
| 262 | | - | 46diagnostictestsormedicalorsurgicalservices; |
|---|
| 263 | | - | 47 (d)Delegatingprofessionalresponsibilitiestoapersonwhoisnotqualifiedby |
|---|
| 264 | | - | 48training,skill,competency,age,experienceorlicensuretoperformsuchresponsibilities; |
|---|
| 265 | | - | 49 (e)Misrepresentingthatanydisease,ailmentorinfirmitycanbecuredbyamethod, |
|---|
| 266 | | - | 50procedure,treatment,medicineordevice; |
|---|
| 267 | | - | 51 (f)Performingorprescribingmedicalserviceswhichhavebeendeclaredbyboard |
|---|
| 268 | | - | 52ruletobeofnomedicalorosteopathicvalue; |
|---|
| 269 | | - | 53 (g)Finaldisciplinaryactionbyanyprofessionalmedicalorosteopathicassociationor |
|---|
| 270 | | - | 54societyorlicensedhospitalormedicalstaffofsuchhospitalinthisoranyotherstateor |
|---|
| 271 | | - | 55territory,whetheragreedtovoluntarilyornot,andincluding,butnotlimitedto,anyremoval, |
|---|
| 272 | | - | 56suspension,limitation,orrestrictionoftheperson'slicenseorstafforhospitalprivileges, |
|---|
| 273 | | - | 57failuretorenewsuchprivilegesorlicenseforcause,orotherfinaldisciplinaryaction,ifthe |
|---|
| 274 | | - | 58actionwasinanywayrelatedtounprofessionalconduct,professionalincompetence, |
|---|
| 275 | | - | 59malpracticeoranyotherviolationofanyprovisionofthischapter; |
|---|
| 276 | | - | 60 (h)Signingablankprescriptionform;ordispensing,prescribing,administeringor |
|---|
| 277 | | - | 61otherwisedistributinganydrug,controlledsubstanceorothertreatmentwithoutsufficient |
|---|
| 278 | | - | 62examinationincludingfailingtoestablishavalidphysician-patientrelationshippursuantto |
|---|
| 279 | | - | 63section334.108,orforotherthanmedicallyacceptedtherapeuticorexperimentalor |
|---|
| 280 | | - | 64investigativepurposesdulyauthorizedbyastateorfederalagency,ornotinthecourseof |
|---|
| 281 | | - | 65professionalpractice,ornotingoodfaithtorelievepainandsuffering,ornottocurean |
|---|
| 282 | | - | 66ailment,physicalinfirmityordisease,exceptasauthorizedinsection334.104; |
|---|
| 283 | | - | 67 (i)Exercisinginfluencewithinaphysician-patientrelationshipforpurposesof |
|---|
| 284 | | - | 68engagingapatientinsexualactivity; |
|---|
| 285 | | - | 69 (j)Beinglistedonanystateorfederalsexualoffenderregistry; |
|---|
| 286 | | - | 70 (k)Terminatingthemedicalcareofapatientwithoutadequatenoticeorwithout |
|---|
| 287 | | - | 71makingotherarrangementsforthecontinuedcareofthepatient; |
|---|
| 288 | | - | CCS#2SSHB2149 8 72 (l)Failingtofurnishdetailsofapatient'smedicalrecordstoothertreatingphysicians |
|---|
| 289 | | - | 73orhospitalsuponproperrequest;orfailingtocomplywithanyotherlawrelatingtomedical |
|---|
| 290 | | - | 74records; |
|---|
| 291 | | - | 75 (m)Failureofanyapplicantorlicenseetocooperatewiththeboardduringany |
|---|
| 292 | | - | 76investigation; |
|---|
| 293 | | - | 77 (n)Failuretocomplywithanysubpoenaorsubpoenaducestecumfromtheboardor |
|---|
| 294 | | - | 78anorderoftheboard; |
|---|
| 295 | | - | 79 (o)Failuretotimelypaylicenserenewalfeesspecifiedinthischapter; |
|---|
| 296 | | - | 80 (p)Violatingaprobationagreement,order,orothersettlementagreementwiththis |
|---|
| 297 | | - | 81boardoranyotherlicensingagency; |
|---|
| 298 | | - | 82 (q)Failingtoinformtheboardofthephysician'scurrentresidenceandbusiness |
|---|
| 299 | | - | 83address; |
|---|
| 300 | | - | 84 (r)Advertisingbyanapplicantorlicenseewhichisfalseormisleading,orwhich |
|---|
| 301 | | - | 85violatesanyruleoftheboard,orwhichclaimswithoutsubstantiationthepositivecureofany |
|---|
| 302 | | - | 86disease,orprofessionalsuperioritytoorgreaterskillthanthatpossessedbyanyother |
|---|
| 303 | | - | 87physician.Anapplicantorlicenseeshallalsobeinviolationofthisprovisioniftheapplicant |
|---|
| 304 | | - | 88orlicenseehasafinancialinterestinanyorganization,corporationorassociationwhichissues |
|---|
| 305 | | - | 89orconductssuchadvertising; |
|---|
| 306 | | - | 90 (s)Anyotherconductthatisunethicalorunprofessionalinvolvingaminor; |
|---|
| 307 | | - | 91 (5)Anyconductorpracticewhichisormightbeharmfulordangeroustothemental |
|---|
| 308 | | - | 92orphysicalhealthofapatientorthepublic;orincompetency,grossnegligenceorrepeated |
|---|
| 309 | | - | 93negligenceintheperformanceofthefunctionsordutiesofanyprofessionlicensedor |
|---|
| 310 | | - | 94regulatedbythischapter.Forthepurposesofthissubdivision,"repeatednegligence"means |
|---|
| 311 | | - | 95thefailure,onmorethanoneoccasion,tousethatdegreeofskillandlearningordinarilyused |
|---|
| 312 | | - | 96underthesameorsimilarcircumstancesbythememberoftheapplicant'sorlicensee's |
|---|
| 313 | | - | 97profession; |
|---|
| 314 | | - | 98 (6)Violationof,orattemptingtoviolate,directlyorindirectly,orassistingor |
|---|
| 315 | | - | 99enablinganypersontoviolate,anyprovisionofthischapterorchapter324,orofanylawful |
|---|
| 316 | | - | 100ruleorregulationadoptedpursuanttothischapterorchapter324; |
|---|
| 317 | | - | 101 (7)Impersonationofanypersonholdingacertificateofregistrationorauthority, |
|---|
| 318 | | - | 102permitorlicenseorallowinganypersontousehisorhercertificateofregistrationor |
|---|
| 319 | | - | 103authority,permit,licenseordiplomafromanyschool; |
|---|
| 320 | | - | 104 (8)Revocation,suspension,restriction,modification,limitation,reprimand,warning, |
|---|
| 321 | | - | 105censure,probationorotherfinaldisciplinaryactionagainsttheholderoforapplicantfora |
|---|
| 322 | | - | 106licenseorotherrighttopracticeanyprofessionregulatedbythischapterbyanotherstate, |
|---|
| 323 | | - | 107territory,federalagencyorcountry,whetherornotvoluntarilyagreedtobythelicenseeor |
|---|
| 324 | | - | 108applicant,including,butnotlimitedto,thedenialoflicensure,surrenderofthelicense, |
|---|
| 325 | | - | CCS#2SSHB2149 9 109allowingthelicensetoexpireorlapse,ordiscontinuingorlimitingthepracticeofmedicine |
|---|
| 326 | | - | 110whilesubjecttoaninvestigationorwhileactuallyunderinvestigationbyanylicensing |
|---|
| 327 | | - | 111authority,medicalfacility,branchoftheArmedForcesoftheUnitedStatesofAmerica, |
|---|
| 328 | | - | 112insurancecompany,court,agencyofthestateorfederalgovernment,oremployer; |
|---|
| 329 | | - | 113 (9)Apersonisfinallyadjudgedincapacitatedordisabledbyacourtofcompetent |
|---|
| 330 | | - | 114jurisdiction; |
|---|
| 331 | | - | 115 (10)Assistingorenablinganypersontopracticeoroffertopracticeanyprofession |
|---|
| 332 | | - | 116licensedorregulatedbythischapterwhoisnotregisteredandcurrentlyeligibletopractice |
|---|
| 333 | | - | 117pursuanttothischapter;orknowinglyperforminganyactwhichinanywayaids,assists, |
|---|
| 334 | | - | 118procures,advises,orencouragesanypersontopracticemedicinewhoisnotregisteredand |
|---|
| 335 | | - | 119currentlyeligibletopracticepursuanttothischapter.Aphysicianwhoworksinaccordance |
|---|
| 336 | | - | 120withstandingordersorprotocolsorinaccordancewiththeprovisionsofsection334.104 |
|---|
| 337 | | - | 121shallnotbeinviolationofthissubdivision; |
|---|
| 338 | | - | 122 (11)Issuanceofacertificateofregistrationorauthority,permitorlicensebasedupon |
|---|
| 339 | | - | 123amaterialmistakeoffact; |
|---|
| 340 | | - | 124 (12)Failuretodisplayavalidcertificateorlicenseifsorequiredbythischapteror |
|---|
| 341 | | - | 125anyrulepromulgatedpursuanttothischapter; |
|---|
| 342 | | - | 126 (13)Violationofthedruglawsorrulesandregulationsofthisstate,includingbutnot |
|---|
| 343 | | - | 127limitedtoanyprovisionofchapter195,anyotherstate,orthefederalgovernment; |
|---|
| 344 | | - | 128 (14)Knowinglymaking,orcausingtobemade,oraiding,orabettinginthemaking |
|---|
| 345 | | - | 129of,afalsestatementinanybirth,deathorothercertificateordocumentexecutedin |
|---|
| 346 | | - | 130connectionwiththepracticeoftheperson'sprofession; |
|---|
| 347 | | - | 131 (15)Knowinglymakingafalsestatement,orallyorinwritingtotheboard; |
|---|
| 348 | | - | 132 (16)Solicitingpatronageinpersonorbyagentsorrepresentatives,orbyanyother |
|---|
| 349 | | - | 133meansormanner,undertheperson'sownnameorunderthenameofanotherpersonor |
|---|
| 350 | | - | 134concern,actualorpretended,insuchamannerastoconfuse,deceive,ormisleadthepublicas |
|---|
| 351 | | - | 135totheneedornecessityfororappropriatenessofhealthcareservicesforallpatients,orthe |
|---|
| 352 | | - | 136qualificationsofanindividualpersonorpersonstodiagnose,render,orperformhealthcare |
|---|
| 353 | | - | 137services; |
|---|
| 354 | | - | 138 (17)Using,orpermittingtheuseof,theperson'snameunderthedesignationof |
|---|
| 355 | | - | 139"Doctor","Dr.","M.D.",or"D.O.",oranysimilardesignationwithreferencetothe |
|---|
| 356 | | - | 140commercialexploitationofanygoods,waresormerchandise; |
|---|
| 357 | | - | 141 (18)Knowinglymakingorcausingtobemadeafalsestatementormisrepresentation |
|---|
| 358 | | - | 142ofamaterialfact,withintenttodefraud,forpaymentpursuanttotheprovisionsofchapter |
|---|
| 359 | | - | 143208orchapter630orforpaymentfromTitleXVIIIorTitleXIXoftheSocialSecurityAct; |
|---|
| 360 | | - | 144 (19)Failureorrefusaltoproperlyguardagainstcontagious,infectiousor |
|---|
| 361 | | - | 145communicablediseasesorthespreadthereof;maintaininganunsanitaryofficeor |
|---|
| 362 | | - | CCS#2SSHB2149 10 146performingprofessionalservicesunderunsanitaryconditions;orfailuretoreportthe |
|---|
| 363 | | - | 147existenceofanunsanitaryconditionintheofficeofaphysicianorinanyhealthcarefacility |
|---|
| 364 | | - | 148totheboard,inwriting,withinthirtydaysafterthediscoverythereof; |
|---|
| 365 | | - | 149 (20)Anycandidateforlicensureorpersonlicensedtopracticeasaphysicaltherapist, |
|---|
| 366 | | - | 150payingorofferingtopayareferralfeeor,notwithstandingsection334.010tothecontrary, |
|---|
| 367 | | - | 151practicingorofferingtopracticeprofessionalphysicaltherapyindependentoftheprescription |
|---|
| 368 | | - | 152anddirectionofapersonlicensedandregisteredasaphysicianandsurgeonpursuanttothis |
|---|
| 369 | | - | 153chapter,asadentistpursuanttochapter332,asapodiatristpursuanttochapter330,asan |
|---|
| 370 | | - | 154advancedpracticeregisterednurseunderchapter335,oranylicensedandregistered |
|---|
| 371 | | - | 155physician,dentist,podiatrist,oradvancedpracticeregisterednursepracticinginanother |
|---|
| 372 | | - | 156jurisdiction,whoselicenseisingoodstanding; |
|---|
| 373 | | - | 157 (21)Anycandidateforlicensureorpersonlicensedtopracticeasaphysicaltherapist, |
|---|
| 374 | | - | 158treatingorattemptingtotreatailmentsorotherhealthconditionsofhumanbeingsotherthan |
|---|
| 375 | | - | 159byprofessionalphysicaltherapyandasauthorizedbysections334.500to334.620; |
|---|
| 376 | | - | 160 (22)Anypersonlicensedtopracticeasaphysicianorsurgeon,requiring,asa |
|---|
| 377 | | - | 161conditionofthephysician-patientrelationship,thatthepatientreceiveprescribeddrugs, |
|---|
| 378 | | - | 162devicesorotherprofessionalservicesdirectlyfromfacilitiesofthatphysician'sofficeorother |
|---|
| 379 | | - | 163entitiesunderthatphysician'sownershiporcontrol.Aphysicianshallprovidethepatient |
|---|
| 380 | | - | 164withaprescriptionwhichmaybetakentothefacilityselectedbythepatientandaphysician |
|---|
| 381 | | - | 165knowinglyfailingtodisclosetoapatientonaformapprovedbytheadvisorycommissionfor |
|---|
| 382 | | - | 166professionalphysicaltherapistsasestablishedbysection334.625whichisdatedandsigned |
|---|
| 383 | | - | 167byapatientorguardianacknowledgingthatthepatientorguardianhasreadandunderstands |
|---|
| 384 | | - | 168thatthephysicianhasapecuniaryinterestinaphysicaltherapyorrehabilitationservice |
|---|
| 385 | | - | 169providingprescribedtreatmentandthattheprescribedtreatmentisavailableonacompetitive |
|---|
| 386 | | - | 170basis.Thissubdivisionshallnotapplytoareferralbyonephysiciantoanotherphysician |
|---|
| 387 | | - | 171withinagroupofphysicianspracticingtogether; |
|---|
| 388 | | - | 172 (23)Apatternofpersonaluseorconsumptionofanycontrolledsubstanceunlessitis |
|---|
| 389 | | - | 173prescribed,dispensedoradministeredbyanotherphysicianwhoisauthorizedbylawtodoso; |
|---|
| 390 | | - | 174 (24)Habitualintoxicationordependenceonalcohol,evidenceofwhichmayinclude |
|---|
| 391 | | - | 175morethanonealcohol-relatedenforcementcontactasdefinedbysection302.525; |
|---|
| 392 | | - | 176 (25)Failuretocomplywithatreatmentprogramoranaftercareprogramenteredinto |
|---|
| 393 | | - | 177aspartofaboardorder,settlementagreementorlicensee'sprofessionalhealthprogram; |
|---|
| 394 | | - | 178 (26)Revocation,suspension,limitation,probation,orrestrictionofanykind |
|---|
| 395 | | - | 179whatsoeverofanycontrolledsubstanceauthority,whetheragreedtovoluntarilyornot,or |
|---|
| 396 | | - | 180voluntaryterminationofacontrolledsubstanceauthoritywhileunderinvestigation; |
|---|
| 397 | | - | 181 (27)Foraphysiciantooperate,conduct,manage,orestablishanabortionfacility,or |
|---|
| 398 | | - | 182foraphysiciantoperformanabortioninanabortionfacility,ifsuchfacilitycomesunderthe |
|---|
| 399 | | - | CCS#2SSHB2149 11 183definitionofanambulatorysurgicalcenterpursuanttosections197.200to197.240,andsuch |
|---|
| 400 | | - | 184facilityhasfailedtoobtainorrenewalicenseasanambulatorysurgicalcenter. |
|---|
| 401 | | - | 185 3.Collaborativepracticearrangements,protocolsandstandingordersshallbein |
|---|
| 402 | | - | 186writingandsignedanddatedbyaphysicianpriortotheirimplementation. |
|---|
| 403 | | - | 187 4.Afterthefilingofsuchcomplaintbeforetheadministrativehearingcommission, |
|---|
| 404 | | - | 188theproceedingsshallbeconductedinaccordancewiththeprovisionsofchapter621.Upona |
|---|
| 405 | | - | 189findingbytheadministrativehearingcommissionthatthegrounds,providedinsubsection2 |
|---|
| 406 | | - | 190ofthissection,fordisciplinaryactionaremet,theboardmay,singlyorincombination,warn, |
|---|
| 407 | | - | 191censureorplacethepersonnamedinthecomplaintonprobationonsuchtermsand |
|---|
| 408 | | - | 192conditionsastheboarddeemsappropriateforaperiodnottoexceedtenyears,ormay |
|---|
| 409 | | - | 193suspendtheperson'slicense,certificateorpermitforaperiodnottoexceedthreeyears,or |
|---|
| 410 | | - | 194restrictorlimittheperson'slicense,certificateorpermitforanindefiniteperiodoftime,or |
|---|
| 411 | | - | 195revoketheperson'slicense,certificate,orpermit,oradministerapublicorprivatereprimand, |
|---|
| 412 | | - | 196ordenytheperson'sapplicationforalicense,orpermanentlywithholdissuanceofalicenseor |
|---|
| 413 | | - | 197requirethepersontosubmittothecare,counselingortreatmentofphysiciansdesignatedby |
|---|
| 414 | | - | 198theboardattheexpenseoftheindividualtobeexamined,orrequirethepersontoattendsuch |
|---|
| 415 | | - | 199continuingeducationalcoursesandpasssuchexaminationsastheboardmaydirect. |
|---|
| 416 | | - | 200 5.Inanyorderofrevocation,theboardmayprovidethatthepersonmaynotapplyfor |
|---|
| 417 | | - | 201reinstatementoftheperson'slicenseforaperiodoftimerangingfromtwotosevenyears |
|---|
| 418 | | - | 202followingthedateoftheorderofrevocation.Allstayordersshalltollthistimeperiod. |
|---|
| 419 | | - | 203 6.Beforerestoringtogoodstandingalicense,certificateorpermitissuedpursuantto |
|---|
| 420 | | - | 204thischapterwhichhasbeeninarevoked,suspendedorinactivestateforanycauseformore |
|---|
| 421 | | - | 205thantwoyears,theboardmayrequiretheapplicanttoattendsuchcontinuingmedical |
|---|
| 422 | | - | 206educationcoursesandpasssuchexaminationsastheboardmaydirect. |
|---|
| 423 | | - | 207 7.Inanyinvestigation,hearingorotherproceedingtodeterminealicensee'sor |
|---|
| 424 | | - | 208applicant'sfitnesstopractice,anyrecordrelatingtoanypatientofthelicenseeorapplicant |
|---|
| 425 | | - | 209shallbediscoverablebytheboardandadmissibleintoevidence,regardlessofanystatutoryor |
|---|
| 426 | | - | 210commonlawprivilegewhichsuchlicensee,applicant,recordcustodianorpatientmight |
|---|
| 427 | | - | 211otherwiseinvoke.Inaddition,nosuchlicensee,applicant,orrecordcustodianmaywithhold |
|---|
| 428 | | - | 212recordsortestimonybearinguponalicensee'sorapplicant'sfitnesstopracticeontheground |
|---|
| 429 | | - | 213ofprivilegebetweensuchlicensee,applicantorrecordcustodianandapatient. |
|---|
| 430 | | - | 214 8.Theactoflawfullydispensing,prescribing,administering,orotherwise |
|---|
| 431 | | - | 215distributingivermectintabletsorhydroxychloroquinesulfatetabletsforhumanuse |
|---|
| 432 | | - | 216shallnotbegroundsfordenial,suspension,revocation,orotherdisciplinaryactionby |
|---|
| 433 | | - | 217theboard. |
|---|
| 434 | | - | 334.530.1.Acandidateforlicensetopracticeasaphysicaltherapistshallfurnish |
|---|
| 435 | | - | 2evidenceofsuchperson'seducationalqualificationsbysubmittingsatisfactoryevidenceof |
|---|
| 436 | | - | CCS#2SSHB2149 12 3completionofaprogramofphysicaltherapyeducationapprovedasreputablebytheboardor |
|---|
| 437 | | - | 4eligibilitytograduatefromsuchaprogramwithinninetydays. Acandidatewhopresents |
|---|
| 438 | | - | 5satisfactoryevidenceoftheperson'sgraduationfromaschoolofphysicaltherapyapprovedas |
|---|
| 439 | | - | 6reputablebytheAmericanMedicalAssociationor,ifgraduatedbefore1936,bytheAmerican |
|---|
| 440 | | - | 7PhysicalTherapyAssociation,orifgraduatedafter1988,theCommissiononAccreditation |
|---|
| 441 | | - | 8forPhysicalTherapyEducationoritssuccessor,isdeemedtohavecompliedwiththe |
|---|
| 442 | | - | 9educationalqualificationsofthissubsection. |
|---|
| 443 | | - | 10 2.Personsdesiringtopracticeasphysicaltherapistsinthisstateshallappearbefore |
|---|
| 444 | | - | 11theboardatsuchtimeandplaceastheboardmaydirectandbeexaminedastotheirfitnessto |
|---|
| 445 | | - | 12engageinsuchpractice.Applicantsshallmeetthequalifyingstandardsforsuch |
|---|
| 446 | | - | 13examinations,includinganyrequirementsestablishedbyanyentitycontractedbythe |
|---|
| 447 | | - | 14boardtoadministertheboard-approvedexamination.Applicationsforexaminationshall |
|---|
| 448 | | - | 15beinwriting,onaformfurnishedbytheboardandshallincludeevidencesatisfactorytothe |
|---|
| 449 | | - | 16boardthattheapplicantpossessesthequalificationssetforthinsubsection1ofthissection |
|---|
| 450 | | - | 17andmeetstherequirementsestablishedtoqualifyforexamination. Eachapplication |
|---|
| 451 | | - | 18shallcontainastatementthatitismadeunderoathoraffirmationandthatitsrepresentations |
|---|
| 452 | | - | 19aretrueandcorrecttothebestknowledgeandbeliefoftheapplicant,subjecttothepenalties |
|---|
| 453 | | - | 20ofmakingafalseaffidavitordeclaration. |
|---|
| 454 | | - | 21 3.Theexaminationofqualifiedcandidatesforlicensestopracticephysicaltherapy |
|---|
| 455 | | - | 22shalltestentry-levelcompetenceasrelatedtophysicaltherapytheory,examinationand |
|---|
| 456 | | - | 23evaluation,physicaltherapydiagnosis,prognosis,treatment,intervention,prevention,and |
|---|
| 457 | | - | 24consultation. |
|---|
| 458 | | - | 25 4.Theexaminationshallembrace,inrelationtothehumanbeing,thesubjectsof |
|---|
| 459 | | - | 26anatomy,chemistry,kinesiology,pathology,physics,physiology,psychology,physical |
|---|
| 460 | | - | 27therapytheoryandproceduresasrelatedtomedicine,surgeryandpsychiatry,andsuch |
|---|
| 461 | | - | 28othersubjects,includingmedicalethics,astheboarddeemsusefultotestthefitnessofthe |
|---|
| 462 | | - | 29candidatetopracticephysicaltherapy. |
|---|
| 463 | | - | 30 5.Nopersonwhohasfailedonsixormoreoccasionstoachieveapassingscore |
|---|
| 464 | | - | 31ontheexaminationrequiredbythissectionshallbeeligibleforlicensurebyexamination |
|---|
| 465 | | - | 32underthissection. |
|---|
| 466 | | - | 33 6.Theapplicantshallpassatestadministeredbytheboardonthelawsandrules |
|---|
| 467 | | - | 34relatedtothepracticeofphysicaltherapyinMissouri. |
|---|
| 468 | | - | 334.655.1.Acandidateforlicensuretopracticeasaphysicaltherapistassistantshall |
|---|
| 469 | | - | 2furnishevidenceoftheperson'seducationalqualifications.Theeducationalrequirementsfor |
|---|
| 470 | | - | 3licensureasaphysicaltherapistassistantare: |
|---|
| 471 | | - | 4 (1)Acertificateofgraduationfromanaccreditedhighschooloritsequivalent;and |
|---|
| 472 | | - | CCS#2SSHB2149 13 5 (2)Satisfactoryevidenceofcompletionofanassociatedegreeprogramofphysical |
|---|
| 473 | | - | 6therapyeducationaccreditedbythecommissiononaccreditationofphysicaltherapy |
|---|
| 474 | | - | 7educationoreligibilitytograduatefromsuchaprogramwithinninetydays. |
|---|
| 475 | | - | 8 2.Personsdesiringtopracticeasaphysicaltherapistassistantinthisstateshall |
|---|
| 476 | | - | 9appearbeforetheboardatsuchtimeandplaceastheboardmaydirectandbeexaminedasto |
|---|
| 477 | | - | 10theperson'sfitnesstoengageinsuchpractice.Applicantsshallmeetthequalifying |
|---|
| 478 | | - | 11standardsforsuchexaminations,includinganyrequirementsestablishedbyanyentity |
|---|
| 479 | | - | 12contractedbytheboardtoadministertheboard-approvedexamination.Applications |
|---|
| 480 | | - | 13forexaminationshallbeonaformfurnishedbytheboardandshallincludeevidence |
|---|
| 481 | | - | 14satisfactorytotheboardthattheapplicantpossessesthequalificationsprovidedinsubsection |
|---|
| 482 | | - | 151ofthissectionandmeetstherequirementsestablishedtoqualifyforexamination. Each |
|---|
| 483 | | - | 16applicationshallcontainastatementthatthestatementismadeunderoathofaffirmationand |
|---|
| 484 | | - | 17thatitsrepresentationsaretrueandcorrecttothebestknowledgeandbeliefoftheperson |
|---|
| 485 | | - | 18signingthestatement,subjecttothepenaltiesofmakingafalseaffidavitordeclaration. |
|---|
| 486 | | - | 19 3.Theexaminationofqualifiedcandidatesforlicensuretopracticeasphysical |
|---|
| 487 | | - | 20therapistassistantsshallembraceanexaminationwhichshallcoverthecurriculumtaughtin |
|---|
| 488 | | - | 21accreditedassociatedegreeprogramsofphysicaltherapyassistanteducation.Such |
|---|
| 489 | | - | 22examinationshallbesufficienttotestthequalificationofthecandidatesaspractitioners. |
|---|
| 490 | | - | 23 4.Theexaminationshallinclude,asrelatedtothehumanbody,thesubjectsof |
|---|
| 491 | | - | 24anatomy,kinesiology,pathology,physiology,psychology,physicaltherapytheoryand |
|---|
| 492 | | - | 25proceduresasrelatedtomedicineandsuchothersubjects,includingmedicalethics,asthe |
|---|
| 493 | | - | 26boarddeemsusefultotestthefitnessofthecandidatetopracticeasaphysicaltherapist |
|---|
| 494 | | - | 27assistant. |
|---|
| 495 | | - | 28 5.Nopersonwhohasfailedonsixormoreoccasionstoachieveapassingscore |
|---|
| 496 | | - | 29ontheexaminationrequiredbythissectionshallbeeligibleforlicensurebyexamination |
|---|
| 497 | | - | 30underthissection. |
|---|
| 498 | | - | 31 6.Theapplicantshallpassatestadministeredbytheboardonthelawsandrules |
|---|
| 499 | | - | 32relatedtothepracticeasaphysicaltherapistassistantinthisstate. |
|---|
| 500 | | - | 33 [6.]7.Theboardshalllicensewithoutexaminationanylegallyqualifiedpersonwho |
|---|
| 501 | | - | 34isaresidentofthisstateandwhowasactivelyengagedinpracticeasaphysicaltherapist |
|---|
| 502 | | - | 35assistantonAugust28,1993.Theboardmaylicensesuchpersonpursuanttothissubsection |
|---|
| 503 | | - | 36untilninetydaysaftertheeffectivedateofthissection. |
|---|
| 504 | | - | 37 [7.]8.Acandidatetopracticeasaphysicaltherapistassistantwhodoesnotmeetthe |
|---|
| 505 | | - | 38educationalqualificationsmaysubmittotheboardanapplicationforexaminationifsuch |
|---|
| 506 | | - | 39personcanfurnishwrittenevidencetotheboardthatthepersonhasbeenemployedinthis |
|---|
| 507 | | - | 40stateforatleastthreeofthelastfiveyearsunderthesupervisionofalicensedphysical |
|---|
| 508 | | - | 41therapistandsuchpersonpossessestheknowledgeandtrainingequivalenttothatobtainedin |
|---|
| 509 | | - | CCS#2SSHB2149 14 42anaccreditedschool.Theboardmaylicensesuchpersonspursuanttothissubsectionuntil |
|---|
| 510 | | - | 43ninetydaysafterrulesdevelopedbythestateboardofhealingartsregardingphysical |
|---|
| 511 | | - | 44therapistassistantlicensingbecomeeffective. |
|---|
| 512 | | - | 338.055.1.Theboardmayrefusetoissueanycertificateofregistrationorauthority, |
|---|
| 513 | | - | 2permitorlicenserequiredpursuanttothischapterforoneoranycombinationofcausesstated |
|---|
| 514 | | - | 3insubsection2ofthissectionorifthedesignatedpharmacist-in-charge,manager-in-charge, |
|---|
| 515 | | - | 4oranyofficer,owner,manager,orcontrollingshareholderoftheapplicanthascommittedany |
|---|
| 516 | | - | 5actorpracticeinsubsection2ofthissection.Theboardshallnotifytheapplicantinwriting |
|---|
| 517 | | - | 6ofthereasonsfortherefusalandshalladvisetheapplicantofhisorherrighttofilea |
|---|
| 518 | | - | 7complaintwiththeadministrativehearingcommissionasprovidedbychapter621. |
|---|
| 519 | | - | 8 2.Theboardmaycauseacomplainttobefiledwiththeadministrativehearing |
|---|
| 520 | | - | 9commissionasprovidedbychapter621againstanyholderofanycertificateofregistrationor |
|---|
| 521 | | - | 10authority,permitorlicenserequiredbythischapteroranypersonwhohasfailedtorenewor |
|---|
| 522 | | - | 11hassurrenderedhisorhercertificateofregistrationorauthority,permitorlicenseforanyone |
|---|
| 523 | | - | 12oranycombinationofthefollowingcauses: |
|---|
| 524 | | - | 13 (1)Useofanycontrolledsubstance,asdefinedinchapter195,oralcoholicbeverage |
|---|
| 525 | | - | 14toanextentthatsuchuseimpairsaperson'sabilitytoperformtheworkofanyprofession |
|---|
| 526 | | - | 15licensedorregulatedbythischapter; |
|---|
| 527 | | - | 16 (2)Thepersonhasbeenfinallyadjudicatedandfoundguilty,orenteredapleaof |
|---|
| 528 | | - | 17guiltyornolocontendere,inacriminalprosecutionunderthelawsofanystateorofthe |
|---|
| 529 | | - | 18UnitedStates,foranyoffensereasonablyrelatedtothequalifications,functionsordutiesof |
|---|
| 530 | | - | 19anyprofessionlicensedorregulatedunderthischapter,foranyoffenseanessentialelement |
|---|
| 531 | | - | 20ofwhichisfraud,dishonestyoranactofviolence,orforanyoffenseinvolvingmoral |
|---|
| 532 | | - | 21turpitude,whetherornotsentenceisimposed; |
|---|
| 533 | | - | 22 (3)Useoffraud,deception,misrepresentationorbriberyinsecuringanycertificateof |
|---|
| 534 | | - | 23registrationorauthority,permitorlicenseissuedpursuanttothischapterorinobtaining |
|---|
| 535 | | - | 24permissiontotakeanyexaminationgivenorrequiredpursuanttothischapter; |
|---|
| 536 | | - | 25 (4)Obtainingorattemptingtoobtainanyfee,charge,tuitionorothercompensation |
|---|
| 537 | | - | 26byfraud,deceptionormisrepresentation; |
|---|
| 538 | | - | 27 (5)Incompetence,misconduct,grossnegligence,fraud,misrepresentationor |
|---|
| 539 | | - | 28dishonestyintheperformanceofthefunctionsordutiesofanyprofessionlicensedor |
|---|
| 540 | | - | 29regulatedbythischapter; |
|---|
| 541 | | - | 30 (6)Violationof,orassistingorenablinganypersontoviolate,anyprovisionofthis |
|---|
| 542 | | - | 31chapter,orofanylawfulruleorregulationadoptedpursuanttothischapter; |
|---|
| 543 | | - | 32 (7)Impersonationofanypersonholdingacertificateofregistrationorauthority, |
|---|
| 544 | | - | 33permitorlicenseorallowinganypersontousehisorhercertificateofregistrationor |
|---|
| 545 | | - | 34authority,permit,license,ordiplomafromanyschool; |
|---|
| 546 | | - | CCS#2SSHB2149 15 35 (8)Denialoflicensuretoanapplicantordisciplinaryactionagainstanapplicantor |
|---|
| 547 | | - | 36theholderofalicenseorotherrighttopracticeanyprofessionregulatedbythischapter |
|---|
| 548 | | - | 37grantedbyanotherstate,territory,federalagency,orcountrywhetherornotvoluntarily |
|---|
| 549 | | - | 38agreedtobythelicenseeorapplicant,including,butnotlimitedto,surrenderofthelicense |
|---|
| 550 | | - | 39upongroundsforwhichdenialordisciplineisauthorizedinthisstate; |
|---|
| 551 | | - | 40 (9)Apersonisfinallyadjudgedincapacitatedbyacourtofcompetentjurisdiction; |
|---|
| 552 | | - | 41 (10)Assistingorenablinganypersontopracticeoroffertopracticeanyprofession |
|---|
| 553 | | - | 42licensedorregulatedbythischapterwhoisnotregisteredandcurrentlyeligibletopractice |
|---|
| 554 | | - | 43underthischapter; |
|---|
| 555 | | - | 44 (11)Issuanceofacertificateofregistrationorauthority,permitorlicensebasedupon |
|---|
| 556 | | - | 45amaterialmistakeoffact; |
|---|
| 557 | | - | 46 (12)Failuretodisplayavalidcertificateorlicenseifsorequiredbythischapteror |
|---|
| 558 | | - | 47anyrulepromulgatedhereunder; |
|---|
| 559 | | - | 48 (13)Violationofanyprofessionaltrustorconfidence; |
|---|
| 560 | | - | 49 (14)Useofanyadvertisementorsolicitationwhichisfalse,misleadingordeceptive |
|---|
| 561 | | - | 50tothegeneralpublicorpersonstowhomtheadvertisementorsolicitationisprimarily |
|---|
| 562 | | - | 51directed; |
|---|
| 563 | | - | 52 (15)Violationofthedruglawsorrulesandregulationsofthisstate,anyotherstateor |
|---|
| 564 | | - | 53thefederalgovernment; |
|---|
| 565 | | - | 54 (16)Theintentionalactofsubstitutingorotherwisechangingthecontent,formulaor |
|---|
| 566 | | - | 55brandofanydrugprescribedbywritten,electronic,ororalprescriptionwithoutpriorwritten |
|---|
| 567 | | - | 56ororalapprovalfromtheprescriberfortherespectivechangeineachprescription;provided, |
|---|
| 568 | | - | 57however,thatnothingcontainedhereinshallprohibitapharmacistfromsubstitutingor |
|---|
| 569 | | - | 58changingthebrandofanydrugasprovidedundersection338.056,andanysuchsubstituting |
|---|
| 570 | | - | 59orchangingofthebrandofanydrugasprovidedforinsection338.056shallnotbedeemed |
|---|
| 571 | | - | 60unprofessionalordishonorableconductunlessaviolationofsection338.056occurs; |
|---|
| 572 | | - | 61 (17)Personaluseorconsumptionofanycontrolledsubstanceunlessitisprescribed, |
|---|
| 573 | | - | 62dispensed,oradministeredbyahealthcareproviderwhoisauthorizedbylawtodoso. |
|---|
| 574 | | - | 63 3.Afterthefilingofsuchcomplaint,theproceedingsshallbeconductedin |
|---|
| 575 | | - | 64accordancewiththeprovisionsofchapter621.Uponafindingbytheadministrativehearing |
|---|
| 576 | | - | 65commissionthatthegrounds,providedinsubsection2ofthissection,fordisciplinaryaction |
|---|
| 577 | | - | 66aremet,theboardmay,singlyorincombination,censureorplacethepersonnamedinthe |
|---|
| 578 | | - | 67complaintonprobationonsuchtermsandconditionsastheboarddeemsappropriatefora |
|---|
| 579 | | - | 68periodnottoexceedfiveyears,ormaysuspend,foraperiodnottoexceedthreeyears,or |
|---|
| 580 | | - | 69revokethelicense,certificate,orpermit.Theboardmayimposeadditionaldisciplineona |
|---|
| 581 | | - | 70licensee,registrant,orpermitteefoundtohaveviolatedanydisciplinarytermspreviously |
|---|
| 582 | | - | 71imposedunderthissectionorbyagreement.Theadditionaldisciplinemayinclude,singlyor |
|---|
| 583 | | - | CCS#2SSHB2149 16 72incombination,censure,placingthelicensee,registrant,orpermitteenamedinthecomplaint |
|---|
| 584 | | - | 73onadditionalprobationonsuchtermsandconditionsastheboarddeemsappropriate,which |
|---|
| 585 | | - | 74additionalprobationshallnotexceedfiveyears,orsuspensionforaperiodnottoexceedthree |
|---|
| 586 | | - | 75years,orrevocationofthelicense,certificate,orpermit. |
|---|
| 587 | | - | 76 4.Iftheboardconcludesthatalicenseeorregistranthascommittedanactoris |
|---|
| 588 | | - | 77engaginginacourseofconductwhichwouldbegroundsfordisciplinaryactionwhich |
|---|
| 589 | | - | 78constitutesaclearandpresentdangertothepublichealthandsafety,theboardmayfilea |
|---|
| 590 | | - | 79complaintbeforetheadministrativehearingcommissionrequestinganexpeditedhearingand |
|---|
| 591 | | - | 80specifyingtheactivitieswhichgiverisetothedangerandthenatureoftheproposed |
|---|
| 592 | | - | 81restrictionorsuspensionofthelicensee'sorregistrant'slicense.Withinfifteendaysafter |
|---|
| 593 | | - | 82serviceofthecomplaintonthelicenseeorregistrant,theadministrativehearingcommission |
|---|
| 594 | | - | 83shallconductapreliminaryhearingtodeterminewhethertheallegedactivitiesofthelicensee |
|---|
| 595 | | - | 84orregistrantappeartoconstituteaclearandpresentdangertothepublichealthandsafety |
|---|
| 596 | | - | 85whichjustifythatthelicensee'sorregistrant'slicenseorregistrationbeimmediatelyrestricted |
|---|
| 597 | | - | 86orsuspended.Theburdenofprovingthattheactionsofalicenseeorregistrantconstitutea |
|---|
| 598 | | - | 87clearandpresentdangertothepublichealthandsafetyshallbeuponthestateboardof |
|---|
| 599 | | - | 88pharmacy.Theadministrativehearingcommissionshallissueitsdecisionimmediatelyafter |
|---|
| 600 | | - | 89thehearingandshalleithergranttotheboardtheauthoritytosuspendorrestrictthelicenseor |
|---|
| 601 | | - | 90dismisstheaction. |
|---|
| 602 | | - | 91 5.Iftheadministrativehearingcommissiongrantstemporaryauthoritytotheboardto |
|---|
| 603 | | - | 92restrictorsuspendthelicensee'sorregistrant'slicense,suchtemporaryauthorityoftheboard |
|---|
| 604 | | - | 93shallbecomefinalauthorityifthereisnorequestbythelicenseeorregistrantforafull |
|---|
| 605 | | - | 94hearingwithinthirtydaysofthepreliminaryhearing.Theadministrativehearingcommission |
|---|
| 606 | | - | 95shall,ifrequestedbythelicenseeorregistrantnamedinthecomplaint,setadatetoholdafull |
|---|
| 607 | | - | 96hearingundertheprovisionsofchapter621regardingtheactivitiesallegedintheinitial |
|---|
| 608 | | - | 97complaintfiledbytheboard. |
|---|
| 609 | | - | 98 6.Iftheadministrativehearingcommissiondismissestheactionfiledbytheboard |
|---|
| 610 | | - | 99pursuanttosubsection4ofthissection,suchdismissalshallnotbartheboardfrominitiating |
|---|
| 611 | | - | 100asubsequentactiononthesamegrounds. |
|---|
| 612 | | - | 101 7.Theboardshallnotdeny,revoke,orsuspend,orotherwisetakeany |
|---|
| 613 | | - | 102disciplinaryactionagainst,acertificateofregistrationorauthority,permit,orlicense |
|---|
| 614 | | - | 103requiredbythischapterforanypersonduetothelawfuldispensing,distributing,or |
|---|
| 615 | | - | 104sellingofivermectintabletsorhydroxychloroquinesulfatetabletsforhumanusein |
|---|
| 616 | | - | 105accordancewithprescriberdirections.Apharmacistshallnotcontacttheprescribing |
|---|
| 617 | | - | 106physicianorthepatienttodisputetheefficacyofivermectintabletsor |
|---|
| 618 | | - | 107hydroxychloroquinesulfatetabletsforhumanuseunlessthephysicianorpatient |
|---|
| 619 | | - | CCS#2SSHB2149 17 108inquiresofthepharmacistabouttheefficacyofivermectintabletsor |
|---|
| 620 | | - | 109hydroxychloroquinesulfatetablets. |
|---|
| 621 | | - | 345.015.Asusedinsections345.010to345.080,thefollowingtermsmean: |
|---|
| 622 | | - | 2 (1)"Audiologist",apersonwhoislicensedasanaudiologistpursuanttosections |
|---|
| 623 | | - | 3345.010to345.080topracticeaudiology; |
|---|
| 624 | | - | 4 (2)"Audiologyaide",apersonwhoisregisteredasanaudiologyaidebytheboard, |
|---|
| 625 | | - | 5whodoesnotactindependentlybutworksunderthedirectionandsupervisionofalicensed |
|---|
| 626 | | - | 6audiologist.Suchpersonassiststheaudiologistwithactivitieswhichrequirean |
|---|
| 627 | | - | 7understandingofaudiologybutdonotrequireformaltrainingintherelevantacademics. |
|---|
| 628 | | - | 8Tobeeligibleforregistrationbytheboard,eachapplicantshallsubmitaregistrationfeeand: |
|---|
| 629 | | - | 9 (a)Beatleasteighteenyearsofage; |
|---|
| 630 | | - | 10 (b)Furnishevidenceoftheperson'seducationalqualificationswhichshallbeata |
|---|
| 631 | | - | 11minimum: |
|---|
| 632 | | - | 12 a.Certificationofgraduationfromanaccreditedhighschooloritsequivalent;and |
|---|
| 633 | | - | 13 b.On-the-jobtraining; |
|---|
| 634 | | - | 14 (c)Beemployedinasettinginwhichdirectandindirectsupervisionareprovidedon |
|---|
| 635 | | - | 15aregularandsystematicbasisbyalicensedaudiologist. |
|---|
| 636 | | - | 16 |
|---|
| 637 | | - | 17However,theaideshallnotadministerorinterprethearingscreeningordiagnostictests,fitor |
|---|
| 638 | | - | 18dispensehearinginstruments,makeearimpressions,makediagnosticstatements,determine |
|---|
| 639 | | - | 19caseselection,presentwrittenreportstoanyoneotherthanthesupervisorwithoutthe |
|---|
| 640 | | - | 20signatureofthesupervisor,makereferralstootherprofessionalsoragencies,useatitleother |
|---|
| 641 | | - | 21thanaudiologyaide,developormodifytreatmentplans,dischargeclientsfromtreatmentor |
|---|
| 642 | | - | 22terminatetreatment,discloseclinicalinformation,eitherorallyorinwriting,toanyoneother |
|---|
| 643 | | - | 23thanthesupervisingaudiologist,orperformanyprocedureforwhichheorsheisnot |
|---|
| 644 | | - | 24qualified,hasnotbeenadequatelytrainedorboth; |
|---|
| 645 | | - | 25 (3)"Board",thestateboardofregistrationforthehealingarts; |
|---|
| 646 | | - | 26 (4)"Clinicalfellowship",thesupervisedprofessionalemploymentperiod |
|---|
| 647 | | - | 27followingcompletionoftheacademicandpracticumrequirementsofanaccredited |
|---|
| 648 | | - | 28trainingprogramunderthischapter; |
|---|
| 649 | | - | 29 (5)"Commission",theadvisorycommissionforspeech-languagepathologistsand |
|---|
| 650 | | - | 30audiologists; |
|---|
| 651 | | - | 31 [(5)](6)"Hearinginstrument"or"hearingaid",anywearabledeviceorinstrument |
|---|
| 652 | | - | 32designedfororofferedforthepurposeofaidingorcompensatingforimpairedhumanhearing |
|---|
| 653 | | - | 33andanyparts,attachmentsoraccessories,includingearmolds,butexcludingbatteries,cords, |
|---|
| 654 | | - | 34receiversandrepairs; |
|---|
| 655 | | - | CCS#2SSHB2149 18 35 [(6)](7)"Person",anyindividual,organization,orcorporatebody,exceptthatonly |
|---|
| 656 | | - | 36individualsmaybelicensedpursuanttosections345.010to345.080; |
|---|
| 657 | | - | 37 [(7)](8)"Practiceofaudiology": |
|---|
| 658 | | - | 38 (a)Theapplicationofacceptedaudiologicprinciples,methodsandproceduresforthe |
|---|
| 659 | | - | 39measurement,testing,interpretation,appraisalandpredictionrelatedtodisordersofthe |
|---|
| 660 | | - | 40auditorysystem,balancesystemorrelatedstructuresandsystems; |
|---|
| 661 | | - | 41 (b)Providesconsultationorcounselingtothepatient,client,student,theirfamilyor |
|---|
| 662 | | - | 42interestedparties; |
|---|
| 663 | | - | 43 (c)Providesacademic,socialandmedicalreferralswhenappropriate; |
|---|
| 664 | | - | 44 (d)Providesforestablishinggoals,implementingstrategies,methodsandtechniques, |
|---|
| 665 | | - | 45forhabilitation,rehabilitationorauralrehabilitation,relatedtodisordersoftheauditory |
|---|
| 666 | | - | 46system,balancesystemorrelatedstructuresandsystems; |
|---|
| 667 | | - | 47 (e)Providesforinvolvementinrelatedresearch,teachingorpubliceducation; |
|---|
| 668 | | - | 48 (f)Providesforrenderingofservicesorparticipatesintheplanning,directingor |
|---|
| 669 | | - | 49conductingofprogramswhicharedesignedtomodifyaudition,communicative,balanceor |
|---|
| 670 | | - | 50cognitivedisorder,whichmayinvolvespeechandlanguageoreducationissues; |
|---|
| 671 | | - | 51 (g)Providesandinterpretsbehavioralandneurophysiologicmeasurementsof |
|---|
| 672 | | - | 52auditorybalance,cognitiveprocessingandrelatedfunctions,includingintraoperative |
|---|
| 673 | | - | 53monitoring; |
|---|
| 674 | | - | 54 (h)Providesinvolvementinanytasks,procedures,actsorpracticesthatarenecessary |
|---|
| 675 | | - | 55forevaluationofaudition,hearing,trainingintheuseofamplificationorassistivelistening |
|---|
| 676 | | - | 56devices; |
|---|
| 677 | | - | 57 (i)Providesselection,assessment,fitting,programming,anddispensingofhearing |
|---|
| 678 | | - | 58instruments,assistivelisteningdevices,andotheramplificationsystems; |
|---|
| 679 | | - | 59 (j)Providesfortakingimpressionsoftheear,makingcustomearmolds,earplugs, |
|---|
| 680 | | - | 60swimmoldsandindustrialnoiseprotectors; |
|---|
| 681 | | - | 61 (k)Providesassessmentofexternalearandcerumenmanagement; |
|---|
| 682 | | - | 62 (l)Providesadvising,fitting,mappingassessmentofimplantabledevicessuchas |
|---|
| 683 | | - | 63cochlearorauditorybrainstemdevices; |
|---|
| 684 | | - | 64 (m)Providesinformationinnoisecontrolandhearingconservationincluding |
|---|
| 685 | | - | 65education,equipmentselection,equipmentcalibration,siteevaluationandemployee |
|---|
| 686 | | - | 66evaluation; |
|---|
| 687 | | - | 67 (n)Providesperformingbasicspeech-languagescreeningtest; |
|---|
| 688 | | - | 68 (o)Providesinvolvementinsocialaspectsofcommunication,includingchallenging |
|---|
| 689 | | - | 69behaviorandineffectivesocialskills,lackofcommunicationopportunities; |
|---|
| 690 | | - | 70 (p)Providessupportandtrainingoffamilymembersandothercommunication |
|---|
| 691 | | - | 71partnersfortheindividualwithauditorybalance,cognitiveandcommunicationdisorders; |
|---|
| 692 | | - | CCS#2SSHB2149 19 72 (q)Providesauralrehabilitationandrelatedservicestoindividualswithhearingloss |
|---|
| 693 | | - | 73andtheirfamilies; |
|---|
| 694 | | - | 74 (r)Evaluates,collaboratesandmanagesauditionproblemsintheassessmentofthe |
|---|
| 695 | | - | 75centralauditoryprocessingdisordersandprovidinginterventionforindividualswithcentral |
|---|
| 696 | | - | 76auditoryprocessingdisorders; |
|---|
| 697 | | - | 77 (s)Developsandmanagesacademicandclinicalproblemsincommunication |
|---|
| 698 | | - | 78sciencesanddisorders; |
|---|
| 699 | | - | 79 (t)Conducts,disseminatesandappliesresearchincommunicationsciencesand |
|---|
| 700 | | - | 80disorders; |
|---|
| 701 | | - | 81 [(8)](9)"Practiceofspeech-languagepathology": |
|---|
| 702 | | - | 82 (a)Providesscreening,identification,assessment,diagnosis,treatment,intervention, |
|---|
| 703 | | - | 83includingbutnotlimitedtoprevention,restoration,ameliorationandcompensation,and |
|---|
| 704 | | - | 84follow-upservicesfordisordersof: |
|---|
| 705 | | - | 85 a.Speech:articulation,fluency,voice,includingrespiration,phonationand |
|---|
| 706 | | - | 86resonance; |
|---|
| 707 | | - | 87 b.Language,involvingtheparametersofphonology,morphology,syntax,semantics |
|---|
| 708 | | - | 88andpragmatic;andincludingdisordersofreceptiveandexpressivecommunicationinoral, |
|---|
| 709 | | - | 89written,graphicandmanualmodalities; |
|---|
| 710 | | - | 90 c.Oral,pharyngeal,cervicalesophagealandrelatedfunctions,suchasdysphagia, |
|---|
| 711 | | - | 91includingdisordersofswallowingandoralfunctionsforfeeding;orofacialmyofunctional |
|---|
| 712 | | - | 92disorders; |
|---|
| 713 | | - | 93 d.Cognitiveaspectsofcommunication,includingcommunicationdisabilityandother |
|---|
| 714 | | - | 94functionaldisabilitiesassociatedwithcognitiveimpairment; |
|---|
| 715 | | - | 95 e.Socialaspectsofcommunication,includingchallengingbehavior,ineffectivesocial |
|---|
| 716 | | - | 96skills,lackofcommunicationopportunities; |
|---|
| 717 | | - | 97 (b)Providesconsultationandcounselingandmakesreferralswhenappropriate; |
|---|
| 718 | | - | 98 (c)Trainsandsupportsfamilymembersandothercommunicationpartnersof |
|---|
| 719 | | - | 99individualswithspeech,voice,language,communicationandswallowingdisabilities; |
|---|
| 720 | | - | 100 (d)Developsandestablisheseffectiveaugmentativeandalternativecommunication |
|---|
| 721 | | - | 101techniquesandstrategies,includingselecting,prescribinganddispensingofaugmentative |
|---|
| 722 | | - | 102aidsanddevices;andthetrainingofindividuals,theirfamiliesandothercommunication |
|---|
| 723 | | - | 103partnersintheiruse; |
|---|
| 724 | | - | 104 (e)Selects,fitsandestablisheseffectiveuseofappropriateprosthetic/adaptive |
|---|
| 725 | | - | 105devicesforspeakingandswallowing,suchastracheoesophagealvalves,electrolarynges,or |
|---|
| 726 | | - | 106speakingvalves; |
|---|
| 727 | | - | 107 (f)Usesinstrumentaltechnologytodiagnoseandtreatdisordersofcommunication |
|---|
| 728 | | - | 108andswallowing,suchasvideofluoroscopy,nasendoscopy,ultrasonographyandstroboscopy; |
|---|
| 729 | | - | CCS#2SSHB2149 20 109 (g)Providesauralrehabilitativeandrelatedcounselingservicestoindividualswith |
|---|
| 730 | | - | 110hearinglossandtotheirfamilies; |
|---|
| 731 | | - | 111 (h)Collaboratesintheassessmentofcentralauditoryprocessingdisordersincasesin |
|---|
| 732 | | - | 112whichthereisevidenceofspeech,languageorothercognitivecommunicationdisorders; |
|---|
| 733 | | - | 113providesinterventionforindividualswithcentralauditoryprocessingdisorders; |
|---|
| 734 | | - | 114 (i)Conductspure-toneairconductionhearingscreeningandscreeningtympanometry |
|---|
| 735 | | - | 115forthepurposeoftheinitialidentificationorreferral; |
|---|
| 736 | | - | 116 (j)Enhancesspeechandlanguageproficiencyandcommunicationeffectiveness, |
|---|
| 737 | | - | 117includingbutnotlimitedtoaccentreduction,collaborationwithteachersofEnglishasa |
|---|
| 738 | | - | 118secondlanguageandimprovementofvoice,performanceandsinging; |
|---|
| 739 | | - | 119 (k)Trainsandsupervisessupportpersonnel; |
|---|
| 740 | | - | 120 (l)Developsandmanagesacademicandclinicalprogramsincommunicationsciences |
|---|
| 741 | | - | 121anddisorders; |
|---|
| 742 | | - | 122 (m)Conducts,disseminatesandappliesresearchincommunicationsciencesand |
|---|
| 743 | | - | 123disorders; |
|---|
| 744 | | - | 124 (n)Measuresoutcomesoftreatmentandconductscontinuousevaluationofthe |
|---|
| 745 | | - | 125effectivenessofpracticesandprogramstoimproveandmaintainqualityofservices; |
|---|
| 746 | | - | 126 [(9)](10)"Speech-languagepathologist",apersonwhoislicensedasaspeech- |
|---|
| 747 | | - | 127languagepathologistpursuanttosections345.010to345.080;whoengagesinthepracticeof |
|---|
| 748 | | - | 128speech-languagepathologyasdefinedinsections345.010to345.080; |
|---|
| 749 | | - | 129 [(10)] (11)"Speech-languagepathologyaide",apersonwhoisregisteredasaspeech- |
|---|
| 750 | | - | 130languageaidebytheboard,whodoesnotactindependentlybutworksunderthedirectionand |
|---|
| 751 | | - | 131supervisionofalicensedspeech-languagepathologist.Suchpersonassiststhespeech- |
|---|
| 752 | | - | 132languagepathologistwithactivitieswhichrequireanunderstandingofspeech-language |
|---|
| 753 | | - | 133pathologybutdonotrequireformaltrainingintherelevantacademics.Tobeeligiblefor |
|---|
| 754 | | - | 134registrationbytheboard,eachapplicantshallsubmitaregistrationfeeand: |
|---|
| 755 | | - | 135 (a)Beatleasteighteenyearsofage; |
|---|
| 756 | | - | 136 (b)Furnishevidenceoftheperson'seducationalqualificationswhichshallbeata |
|---|
| 757 | | - | 137minimum: |
|---|
| 758 | | - | 138 a.Certificationofgraduationfromanaccreditedhighschooloritsequivalent;and |
|---|
| 759 | | - | 139 b.On-the-jobtraining; |
|---|
| 760 | | - | 140 (c)Beemployedinasettinginwhichdirectandindirectsupervisionisprovidedona |
|---|
| 761 | | - | 141regularandsystematicbasisbyalicensedspeech-languagepathologist. |
|---|
| 762 | | - | 142 |
|---|
| 763 | | - | 143However,theaideshallnotadministerorinterprethearingscreeningordiagnostictests,fitor |
|---|
| 764 | | - | 144dispensehearinginstruments,makeearimpressions,makediagnosticstatements,determine |
|---|
| 765 | | - | 145caseselection,presentwrittenreportstoanyoneotherthanthesupervisorwithoutthe |
|---|
| 766 | | - | CCS#2SSHB2149 21 146signatureofthesupervisor,makereferralstootherprofessionalsoragencies,useatitleother |
|---|
| 767 | | - | 147thanspeech-languagepathologyaide,developormodifytreatmentplans,dischargeclients |
|---|
| 768 | | - | 148fromtreatmentorterminatetreatment,discloseclinicalinformation,eitherorallyorin |
|---|
| 769 | | - | 149writing,toanyoneotherthanthesupervisingspeech-languagepathologist,orperformany |
|---|
| 770 | | - | 150procedureforwhichheorsheisnotqualified,hasnotbeenadequatelytrainedorboth; |
|---|
| 771 | | - | 151 [(11)](12)"Speech-languagepathologyassistant",apersonwhoisregisteredasa |
|---|
| 772 | | - | 152speech-languagepathologyassistantbytheboard,whodoesnotactindependentlybutworks |
|---|
| 773 | | - | 153underthedirectionandsupervisionofalicensedspeech-languagepathologistpracticingforat |
|---|
| 774 | | - | 154leastoneyearorspeech-languagepathologistpracticingundersubdivision(1)or(6)of |
|---|
| 775 | | - | 155subsection1ofsection345.025foratleastoneyearandwhoseactivitiesrequireboth |
|---|
| 776 | | - | 156academicandpracticaltraininginthefieldofspeech-languagepathologyalthoughless |
|---|
| 777 | | - | 157trainingthanthoseestablishedbysections345.010to345.080asnecessaryforlicensingasa |
|---|
| 778 | | - | 158speech-languagepathologist.Tobeeligibleforregistrationbytheboard,eachapplicantshall |
|---|
| 779 | | - | 159submittheregistrationfee,supervisingspeech-languagepathologistinformationif |
|---|
| 780 | | - | 160employmentisconfirmed,ifnotsuchinformationshallbeprovidedafterregistration,and |
|---|
| 781 | | - | 161furnishevidenceoftheperson'seducationalqualificationswhichmeetthefollowing: |
|---|
| 782 | | - | 162 (a)Holdabachelor'sleveldegreefromaninstitutionaccreditedorapprovedbya |
|---|
| 783 | | - | 163regionalaccreditingbodyrecognizedbytheUnitedStatesDepartmentofEducationorits |
|---|
| 784 | | - | 164equivalent;and |
|---|
| 785 | | - | 165 (b)Submitofficialtranscriptsfromoneormoreaccreditedcollegesoruniversities |
|---|
| 786 | | - | 166presentingevidenceofthecompletionofbachelor'slevelcourseworkandrequirementsinthe |
|---|
| 787 | | - | 167fieldofspeech-languagepathologyasestablishedbytheboardthroughrulesandregulations; |
|---|
| 788 | | - | 168 (c)Submitproofofcompletionofthenumberandtypeofclinicalhoursas |
|---|
| 789 | | - | 169establishedbytheboardthroughrulesandregulations. |
|---|
| 790 | | - | 345.022.1.Anypersonintheperson'sclinicalfellowshipshallholdaprovisional |
|---|
| 791 | | - | 2licensetopracticespeech-languagepathologyoraudiology.Theboardmayissuea |
|---|
| 792 | | - | 3provisionallicensetoanapplicantwho: |
|---|
| 793 | | - | 4 (1)Hasmettherequirementsforpracticumandacademicrequirementsfroman |
|---|
| 794 | | - | 5accreditedtrainingprogramunderthischapter; |
|---|
| 795 | | - | 6 (2)Submitsanapplicationtotheboardonaformprescribedbytheboard.Such |
|---|
| 796 | | - | 7formshallincludeaplanforthecontentandsupervisionoftheclinicalfellowship,as |
|---|
| 797 | | - | 8wellasevidenceofgoodmoralandethicalcharacter;and |
|---|
| 798 | | - | 9 (3)Submitstotheboardanapplicationfee,assetbytheboard,forthe |
|---|
| 799 | | - | 10provisionallicense. |
|---|
| 800 | | - | 11 2.Aprovisionallicenseiseffectiveforoneyearandmaybeextendedforan |
|---|
| 801 | | - | 12additionaltwelvemonthsonlyforpurposesofcompletingthepostgraduateclinical |
|---|
| 802 | | - | 13experienceportionoftheclinicalfellowship;provided,thattheapplicanthaspassedthe |
|---|
| 803 | | - | CCS#2SSHB2149 22 14nationalexaminationandshallholdamaster'sdegreefromanapprovedtraining |
|---|
| 804 | | - | 15programinhisorherareaofapplication. |
|---|
| 805 | | - | 16 3.Withintwelvemonthsofissuanceoftheprovisionallicense,theapplicantshall |
|---|
| 806 | | - | 17passanexaminationpromulgatedorapprovedbytheboard. |
|---|
| 807 | | - | 18 4.Withintwelvemonthsofissuanceofaprovisionallicense,theapplicantshall |
|---|
| 808 | | - | 19completetherequirementsforthemaster'sordoctoraldegreefromaprogram |
|---|
| 809 | | - | 20accreditedbytheCouncilonAcademicAccreditationoftheAmericanSpeech- |
|---|
| 810 | | - | 21Language-HearingAssociationorotheraccreditingagencyapprovedbytheboardin |
|---|
| 811 | | - | 22theareainwhichlicensureissought. |
|---|
| 812 | | - | 345.050.[1.]Tobeeligibleforlicensurebytheboardbyexamination,eachapplicant |
|---|
| 813 | | - | 2shallsubmittheapplicationfeeandshallfurnishevidenceofsuchperson'scurrent |
|---|
| 814 | | - | 3competenceandshall: |
|---|
| 815 | | - | 4 (1)Holdamaster'soradoctoraldegreefromaprogramthatwasawarded |
|---|
| 816 | | - | 5"accreditationcandidate"statusorisaccreditedbytheCouncilonAcademicAccreditationof |
|---|
| 817 | | - | 6theAmericanSpeech-Language-HearingAssociationorotheraccreditingagencyapproved |
|---|
| 818 | | - | 7bytheboardintheareainwhichlicensureissought; |
|---|
| 819 | | - | 8 (2)Submitofficialtranscriptsfromoneormoreaccreditedcollegesoruniversities |
|---|
| 820 | | - | 9presentingevidenceofthecompletionofcourseworkandclinicalpracticumrequirements |
|---|
| 821 | | - | 10equivalenttothatrequiredbytheCouncilonAcademicAccreditationoftheAmerican |
|---|
| 822 | | - | 11Speech-Language-HearingAssociationorotheraccreditingagencyapprovedbytheboard; |
|---|
| 823 | | - | 12[and] |
|---|
| 824 | | - | 13 (3)Presentwrittenevidenceofcompletionofaclinicalfellowshipfrom |
|---|
| 825 | | - | 14supervisors.Theexperiencerequiredbythissubdivisionshallfollowthecompletionof |
|---|
| 826 | | - | 15therequirementsofsubdivisions(1)and(2)ofthissubsection.Thisperiodof |
|---|
| 827 | | - | 16employmentshallbeunderthedirectsupervisionofapersonwhoislicensedbythestate |
|---|
| 828 | | - | 17ofMissouriintheprofessioninwhichtheapplicantseekstobelicensed.Persons |
|---|
| 829 | | - | 18applyingwithanaudiologyclinicaldoctoraldegreeareexemptfromthisprovision;and |
|---|
| 830 | | - | 19 (4)Passanexaminationpromulgatedorapprovedbytheboard.Theboardshall |
|---|
| 831 | | - | 20determinethesubjectandscopeoftheexaminations. |
|---|
| 832 | | - | 21 [2.Tobeeligibleforlicensurebytheboardwithoutexamination,eachapplicantshall |
|---|
| 833 | | - | 22makeapplicationonformsprescribedbytheboard,submittheapplicationfee,submitan |
|---|
| 834 | | - | 23activitystatementandmeetoneofthefollowingrequirements: |
|---|
| 835 | | - | 24 (1)Theboardshallissuealicensetoanyspeech-languagepathologistoraudiologist |
|---|
| 836 | | - | 25whoislicensedinanothercountryandwhohashadnoviolations,suspensionorrevocations |
|---|
| 837 | | - | 26ofalicensetopracticespeech-languagepathologyoraudiologyinanyjurisdiction;provided |
|---|
| 838 | | - | 27that,suchpersonislicensedinacountrywhoserequirementsaresubstantiallyequalto,or |
|---|
| 839 | | - | 28greaterthan,Missouriatthetimetheapplicantappliesforlicensure;or |
|---|
| 840 | | - | CCS#2SSHB2149 23 29 (2)HoldthecertificateofclinicalcompetenceissuedbytheAmericanSpeech- |
|---|
| 841 | | - | 30Language-HearingAssociationintheareainwhichlicensureissought.] |
|---|
| 842 | | - | 345.052.1.Forpurposesofthissection,thefollowingtermsmean: |
|---|
| 843 | | - | 2 (1)"Board",theMissouriboardofregistrationforthehealingarts; |
|---|
| 844 | | - | 3 (2)"Commission",theadvisorycommissionforspeech-languagepathologists |
|---|
| 845 | | - | 4andaudiologists; |
|---|
| 846 | | - | 5 (3)"License",alicense,certificate,registration,permit,accreditation,or |
|---|
| 847 | | - | 6militaryoccupationalspecialtythatenablesapersontolegallypracticeanoccupationor |
|---|
| 848 | | - | 7professioninaparticularjurisdiction; |
|---|
| 849 | | - | 8 (4)"Military",theArmedForcesoftheUnitedStatesincludingtheAirForce, |
|---|
| 850 | | - | 9Army,CoastGuard,MarineCorps,Navy,SpaceForce,NationalGuard,andanyother |
|---|
| 851 | | - | 10militarybranchthatisdesignatedbyCongressaspartoftheArmedForcesofthe |
|---|
| 852 | | - | 11UnitedStates,andallreservecomponentsandauxiliaries.Suchtermalsoincludesthe |
|---|
| 853 | | - | 12militaryreservesandmilitiaoftheUnitedStatesterritoryorstate; |
|---|
| 854 | | - | 13 (5)"Nonresidentmilitaryspouse",anonresidentspouseofanactiveduty |
|---|
| 855 | | - | 14memberoftheArmedForcesoftheUnitedStateswhohasbeentransferredoris |
|---|
| 856 | | - | 15scheduledtobetransferredtoanadjacentstateandisorwillbedomiciledinthestateof |
|---|
| 857 | | - | 16Missouri,orhasmovedtothestateofMissourionapermanentchange-of-stationbasis; |
|---|
| 858 | | - | 17 (6)"Residentmilitaryspouse",aspouseofanactivedutymemberoftheArmed |
|---|
| 859 | | - | 18ForcesoftheUnitedStateswhohasbeentransferredorisscheduledtobetransferredto |
|---|
| 860 | | - | 19thestateofMissouri,whoisdomiciledinthestateofMissouri,orwhohasMissourias |
|---|
| 861 | | - | 20hisorherhomeofrecord. |
|---|
| 862 | | - | 21 2.Anypersonwhoholdsavalidcurrentspeech-languagepathologistor |
|---|
| 863 | | - | 22audiologistlicenseissuedbyanotherstate,abranchorunitofthemilitary,aterritoryof |
|---|
| 864 | | - | 23theUnitedStates,ortheDistrictofColumbia,andwhohasbeenlicensedforatleastone |
|---|
| 865 | | - | 24yearintheotherjurisdiction,maysubmitanapplicationforaspeech-language |
|---|
| 866 | | - | 25pathologistoraudiologistlicenseinMissourialongwithproofofcurrentlicensureand |
|---|
| 867 | | - | 26proofoflicensureforatleastoneyearintheotherjurisdiction,totheboard. |
|---|
| 868 | | - | 27 3.Theboardshall: |
|---|
| 869 | | - | 28 (1)Withinsixmonthsofreceivinganapplicationdescribedinsubsection2of |
|---|
| 870 | | - | 29thissection,waiveanyexamination,educational,orexperiencerequirementsfor |
|---|
| 871 | | - | 30licensureinthisstatefortheapplicantifitdeterminesthattherewereminimum |
|---|
| 872 | | - | 31educationrequirementsand,ifapplicable,workexperienceandclinicalsupervision |
|---|
| 873 | | - | 32requirementsineffectandtheotherstateverifiesthatthepersonmetthose |
|---|
| 874 | | - | 33requirementsinordertobelicensedorcertifiedinthatstate.Theboardmay |
|---|
| 875 | | - | 34requireanapplicanttotakeandpassanexaminationspecifictothelawsofthisstate;or |
|---|
| 876 | | - | CCS#2SSHB2149 24 35 (2)Withinthirtydaysofreceivinganapplicationdescribedinsubsection2of |
|---|
| 877 | | - | 36thissectionfromanonresidentmilitaryspouseoraresidentmilitaryspouse,waiveany |
|---|
| 878 | | - | 37examination,educational,orexperiencerequirementsforlicensureinthisstateforthe |
|---|
| 879 | | - | 38applicantandissuesuchapplicantalicenseunderthissectionifsuchapplicant |
|---|
| 880 | | - | 39otherwisemeetstherequirementsofthissection. |
|---|
| 881 | | - | 40 4.(1)Theboardshallnotwaiveanyexamination,educational,orexperience |
|---|
| 882 | | - | 41requirementsforanyapplicantwhohashadhisorherlicenserevokedbyaboard |
|---|
| 883 | | - | 42outsidethestate;whoiscurrentlyunderinvestigation,whohasacomplaintpending,or |
|---|
| 884 | | - | 43whoiscurrentlyunderdisciplinaryaction,exceptasprovidedinsubdivision(2)ofthis |
|---|
| 885 | | - | 44subsection,withaboardoutsidethestate;whodoesnotholdalicenseingoodstanding |
|---|
| 886 | | - | 45withaboardoutsidethestate;whohasacriminalrecordthatwoulddisqualifyhimor |
|---|
| 887 | | - | 46herforlicensureinMissouri;orwhodoesnotholdavalidcurrentlicenseintheother |
|---|
| 888 | | - | 47jurisdictiononthedatetheboardreceiveshisorherapplicationunderthissection. |
|---|
| 889 | | - | 48 (2)Ifanotherjurisdictionhastakendisciplinaryactionagainstanapplicant,the |
|---|
| 890 | | - | 49boardshalldetermineifthecausefortheactionwascorrectedandthematterresolved. |
|---|
| 891 | | - | 50Ifthematterhasnotbeenresolvedbythatjurisdiction,theboardmaydenyalicense |
|---|
| 892 | | - | 51untilthematterisresolved. |
|---|
| 893 | | - | 52 5.Nothinginthissectionshallprohibittheboardfromdenyingalicensetoan |
|---|
| 894 | | - | 53applicantunderthissectionforanyreasondescribedinsection345.065. |
|---|
| 895 | | - | 54 6.Anypersonwhoislicensedundertheprovisionsofthissectionshallbesubject |
|---|
| 896 | | - | 55totheboard'sjurisdictionandallrulesandregulationspertainingtothepracticeasa |
|---|
| 897 | | - | 56speech-languagepathologistoraudiologistinthisstate. |
|---|
| 898 | | - | 57 7.Thissectionshallnotbeconstruedtowaiveanyrequirementforanapplicant |
|---|
| 899 | | - | 58topayanyfees. |
|---|
| 14 | + | BEITENACTEDBYTHEGENERALASSEMBLYOFTHESTATEOFMISSOURI,AS |
|---|
| 15 | + | FOLLOWS: |
|---|
| 16 | + | SectionA.Sections197.400,197.445,327.312,327.313, |
|---|
| 17 | + | 2 327.314,327.331,334.100,334.530,334.655,338.055,345.015,and |
|---|
| 18 | + | 3 345.050,RSMo,arerepealedandseventeennewsectionsenactedin |
|---|
| 19 | + | 4 lieuthereof,tobeknownassections197.400,197.445,324.005, |
|---|
| 20 | + | 5 327.312,327.313,327.314,327.331,332.325,334.100,334.530, |
|---|
| 21 | + | 6 334.655,338.055,345.015,345.022,345.050,345.052,and345.085, |
|---|
| 22 | + | 7 toreadasfollows: |
|---|
| 23 | + | 197.400.Asusedinsections197.400to197.475,unlessthe |
|---|
| 24 | + | 2 contextotherwiserequires,thefollowingtermsmean: |
|---|
| 25 | + | 3 (1)"Council",thehomehealthservicesadvisorycouncil |
|---|
| 26 | + | 4 createdbysections197.400to197.475; |
|---|
| 27 | + | 5 (2)"Department",thedepartmentofhealthandsenior |
|---|
| 28 | + | 6 services; |
|---|
| 29 | + | 7 (3)"Homehealthagency",apublicagencyorprivate |
|---|
| 30 | + | 1 8 organizationorasubdivisionorsubunitofanagencyor |
|---|
| 31 | + | 9 organizationthatprovidestwoormorehomehealthservicesatthe |
|---|
| 32 | + | 10 residenceofapatientaccordingtoa[physician's] written[and |
|---|
| 33 | + | 11 signed] planoftreatmentsignedbyaphysician,nurse |
|---|
| 34 | + | 12 practitioner,clinicalnursespecialist,orphysicianassistant; |
|---|
| 35 | + | 13 (4)"Homehealthservices",anyofthefollowingitemsand |
|---|
| 36 | + | 14 servicesprovidedattheresidenceofthepatientonapart-timeor |
|---|
| 37 | + | 15 intermittentbasis:nursing,physicaltherapy,speechtherapy, |
|---|
| 38 | + | 16 occupationaltherapy,homehealthaid,ormedicalsocialservice; |
|---|
| 39 | + | 17 (5)"Nursepractitioner,clinicalnursespecialist",a |
|---|
| 40 | + | 18 personrecognizedbythestateboardofnursingpursuanttothe |
|---|
| 41 | + | 19 provisionsofchapter335topracticeinthisstateasanurse |
|---|
| 42 | + | 20 practitionerorclinicalnursespecialist; |
|---|
| 43 | + | 21 (6)"Part-timeorintermittentbasis",theprovidingofhome |
|---|
| 44 | + | 22 healthservicesinaninterruptedintervalsequenceontheaverage |
|---|
| 45 | + | 23 ofnottoexceedthreehoursinanytwenty-four-hour period; |
|---|
| 46 | + | 24 [(6)] (7)"Patient'sresidence",theactualplaceof |
|---|
| 47 | + | 25 residenceofthepersonreceivinghomehealthservices,including |
|---|
| 48 | + | 26 institutionalresidencesaswellasindividualdwellingunits; |
|---|
| 49 | + | 27 [(7)] (8)"Physician",apersonlicensedbythestateboard |
|---|
| 50 | + | 28 ofregistrationforthehealingartspursuanttotheprovisionsof |
|---|
| 51 | + | 29 chapter334topracticeinthisstateasaphysicianandsurgeon; |
|---|
| 52 | + | 30 (9)"Physicianassistant",apersonlicensedbythestate |
|---|
| 53 | + | 31 boardofregistrationforthehealingartspursuanttothe |
|---|
| 54 | + | 32 provisionsofchapter334topracticeinthisstateasaphysician |
|---|
| 55 | + | 33 assistant; |
|---|
| 56 | + | 34 [(8)] (10)"Planoftreatment",aplanreviewedandsignedas |
|---|
| 57 | + | 2 35 oftenas[medically] necessarybyaphysician[or], podiatrist, |
|---|
| 58 | + | 36 nursepractitioner,clinicalnursespecialist,oraphysician |
|---|
| 59 | + | 37 assistant,nottoexceedsixtydaysinduration,andreviewedbya |
|---|
| 60 | + | 38 physicianatleastonceeverysixmonths,prescribingitemsand |
|---|
| 61 | + | 39 servicesforanindividualpatient'scondition; |
|---|
| 62 | + | 40 [(9)] (11)"Podiatrist",apersonlicensedbythestateboard |
|---|
| 63 | + | 41 ofpodiatrypursuanttotheprovisionsofchapter330topractice |
|---|
| 64 | + | 42 inthisstateasapodiatrist; |
|---|
| 65 | + | 43 [(10)] (12)"Subunit"or"subdivision",anyorganizational |
|---|
| 66 | + | 44 unitofalargerorganizationwhichcanbeclearlydefinedasa |
|---|
| 67 | + | 45 separateentitywithinthelargerstructure,whichcanmeetallof |
|---|
| 68 | + | 46 therequirementsofsections197.400to197.475independentofthe |
|---|
| 69 | + | 47 largerorganization,whichcanbeheldaccountableforthecareof |
|---|
| 70 | + | 48 patientsitisserving,andwhichprovidestoallpatientscareand |
|---|
| 71 | + | 49 servicesmeetingthestandardsandrequirementsofsections |
|---|
| 72 | + | 50 197.400to197.475. |
|---|
| 73 | + | 197.445.1.Thedepartmentmayadoptreasonablerulesand |
|---|
| 74 | + | 2 standardsnecessarytocarryouttheprovisionsofsections |
|---|
| 75 | + | 3 197.400to197.477.Therulesandstandardsadoptedshallnotbe |
|---|
| 76 | + | 4 lessthanthestandardsestablishedbythefederalgovernmentfor |
|---|
| 77 | + | 5 homehealthagenciesunderTitleXVIIIoftheFederalSocial |
|---|
| 78 | + | 6 SecurityAct.Thereasonablerulesandstandardsshallbe |
|---|
| 79 | + | 7 initiallypromulgatedwithinoneyearofSeptember28,1983. |
|---|
| 80 | + | 8 2.Therulesandstandardsadoptedbythedepartmentpursuant |
|---|
| 81 | + | 9 totheprovisionsofsections197.400to197.477shallapplytoall |
|---|
| 82 | + | 10 healthservicescoveredbysections197.400to197.477renderedto |
|---|
| 83 | + | 11 anypatientbeingservedbyahomehealthagencyregardlessof |
|---|
| 84 | + | 3 12 sourceofpaymentfortheservice,patient'scondition,orplaceof |
|---|
| 85 | + | 13 residence,atwhichthehomehealthservicesareorderedbythe |
|---|
| 86 | + | 14 physician[or], podiatrist,nursepractitioner,clinicalnurse |
|---|
| 87 | + | 15 specialist,orphysicianassistant. Noruleorportionofarule |
|---|
| 88 | + | 16 promulgatedpursuanttotheauthorityofsections197.400to |
|---|
| 89 | + | 17 197.477shallbecomeeffectiveunlessithasbeenpromulgated |
|---|
| 90 | + | 18 pursuanttotheprovisionsofsection536.024. |
|---|
| 91 | + | 324.005.1.Notwithstanding anyrequirementsforlicensure |
|---|
| 92 | + | 2 forallprofessionalboards,commissions,committees,andoffices |
|---|
| 93 | + | 3 withinthedivisionofprofessionalregistrationtothecontrary, |
|---|
| 94 | + | 4 aprofessionalwhohasacurrentlicensetopracticefromanother |
|---|
| 95 | + | 5 state,commonwealth,territory,ortheDistrictofColumbiashall |
|---|
| 96 | + | 6 beexemptfromthelicensurerequirementsofhisorherrespective |
|---|
| 97 | + | 7 licensureboardinthisstateif: |
|---|
| 98 | + | 8 (1)Theprofessionalisanactivedutyorreservememberof |
|---|
| 99 | + | 9 theArmedForcesoftheUnitedStates,amemberoftheNational |
|---|
| 100 | + | 10 Guard,acivilianemployeeoftheUnitedStatesDepartmentof |
|---|
| 101 | + | 11 Defense,anauthorizedservicescontractorunder10U.S.C.Section |
|---|
| 102 | + | 12 1091,oraprofessionalotherwiseauthorizedbytheUnitedStates |
|---|
| 103 | + | 13 DepartmentofDefense; |
|---|
| 104 | + | 14 (2)Theprofessionalpracticesthesameoccupationor |
|---|
| 105 | + | 15 professionatthesamepracticelevelforwhichheorsheholdsa |
|---|
| 106 | + | 16 currentlicense;and |
|---|
| 107 | + | 17 (3)Theprofessionalisengagedinthepracticeofa |
|---|
| 108 | + | 18 professionalthroughapartnershipwiththefederalInnovative |
|---|
| 109 | + | 19 ReadinessTrainingprogramwithintheUnitedStatesDepartmentof |
|---|
| 110 | + | 20 Defense. |
|---|
| 111 | + | 4 21 2.Theexemptionprovidedinthissectionshallnotpermita |
|---|
| 112 | + | 22 professionaltoengageinpracticeexceptaspartofthefederal |
|---|
| 113 | + | 23 InnovativeReadinessTrainingprogramwithintheUnitedStates |
|---|
| 114 | + | 24 DepartmentofDefense.Theexemptionshallonlyapplywhile: |
|---|
| 115 | + | 25 (1)Theprofessional'spracticeisrequiredbytheprogram |
|---|
| 116 | + | 26 pursuanttomilitaryorders;and |
|---|
| 117 | + | 27 (2)Theservicesprovidedbytheprofessionalarewithinthe |
|---|
| 118 | + | 28 scopeofpracticefortheindividual'srespectiveprofessionin |
|---|
| 119 | + | 29 thisstate. |
|---|
| 120 | + | 327.312.1.PriortoJanuary1,2024,anypersonmayapply |
|---|
| 121 | + | 2 totheboardforenrollmentasalandsurveyor-in-training whoisa |
|---|
| 122 | + | 3 highschoolgraduate,orwhoholdsaMissouricertificateofhigh |
|---|
| 123 | + | 4 schoolequivalence(GED),andeither: |
|---|
| 124 | + | 5 (1)Hasgraduatedandreceivedabaccalaureatedegreeinan |
|---|
| 125 | + | 6 approvedcurriculumasdefinedbyboardregulationwhichshall |
|---|
| 126 | + | 7 includeatleasttwelvesemesterhoursofapprovedsurveying |
|---|
| 127 | + | 8 courseworkasdefinedbyboardregulationofwhichatleasttwo |
|---|
| 128 | + | 9 semesterhoursshallbeinthelegalaspectsofboundarysurveying; |
|---|
| 129 | + | 10 or |
|---|
| 130 | + | 11 (2)Haspassedatleastsixtyhoursofcollegecreditwhich |
|---|
| 131 | + | 12 shallincludecreditforatleasttwentysemesterhoursofapproved |
|---|
| 132 | + | 13 surveyingcourseworkasdefinedbyboardregulationofwhichat |
|---|
| 133 | + | 14 leasttwosemesterhoursshallbeinlegalaspectsofboundary |
|---|
| 134 | + | 15 surveyingandpresentevidencesatisfactorytotheboardthatin |
|---|
| 135 | + | 16 additiontheretosuchpersonhasatleastoneyearofcombined |
|---|
| 136 | + | 17 professionalofficeandfieldexperienceinlandsurveying |
|---|
| 137 | + | 18 projectsundertheimmediatepersonalsupervisionofa |
|---|
| 138 | + | 5 19 professionallandsurveyor;or |
|---|
| 139 | + | 20 (3)Haspassedatleasttwelvesemesterhoursofapproved |
|---|
| 140 | + | 21 surveyingcourseworkasdefinedbyboardregulationofwhichat |
|---|
| 141 | + | 22 leasttwosemesterhoursshallbeinlegalaspectsofland |
|---|
| 142 | + | 23 surveyingandinadditiontheretohasatleasttwoyearsof |
|---|
| 143 | + | 24 combinedprofessionalofficeandfieldexperienceinland |
|---|
| 144 | + | 25 surveyingprojectsundertheimmediatepersonalsupervisionofa |
|---|
| 145 | + | 26 professionallandsurveyor. Pursuanttothisprovision,notmore |
|---|
| 146 | + | 27 thanoneyearofsatisfactorypostsecondaryeducationworkshall |
|---|
| 147 | + | 28 countasequivalentyearsofsatisfactorylandsurveyingworkas |
|---|
| 148 | + | 29 aforementioned. |
|---|
| 149 | + | 30 2.Theboardshallissueacertificateofcompletiontoeach |
|---|
| 150 | + | 31 applicantwhosatisfiestherequirementsoftheaforementioned |
|---|
| 151 | + | 32 landsurveyor-in-training programandpassessuchexaminationor |
|---|
| 152 | + | 33 examinationsasshallberequiredbytheboard. |
|---|
| 153 | + | 34 3.BeginningJanuary1,2024,anypersonmayapplytothe |
|---|
| 154 | + | 35 boardforenrollmentasalandsurveyor-internwhoisahighschool |
|---|
| 155 | + | 36 graduate,orwhoholdsacertificateofhighschoolequivalence |
|---|
| 156 | + | 37 (GED),andhaspassedanyexaminationrequiredbytheboard |
|---|
| 157 | + | 38 pursuanttosection327.331. |
|---|
| 158 | + | 327.313.Applicationsforenrollmentasaland[surveyor-in- |
|---|
| 159 | + | 2 training] surveyor-intern shallbetypewrittenonprescribedforms |
|---|
| 160 | + | 3 furnishedtotheapplicant. Theapplicationshallcontain |
|---|
| 161 | + | 4 applicant'sstatementsshowingtheapplicant'seducation, |
|---|
| 162 | + | 5 experience,andsuchotherpertinentinformationastheboardmay |
|---|
| 163 | + | 6 require.Eachapplicationshallcontainastatementthatitis |
|---|
| 164 | + | 7 madeunderoathoraffirmationandthattherepresentations are |
|---|
| 165 | + | 6 8 trueandcorrecttothebestknowledgeandbeliefoftheapplicant, |
|---|
| 166 | + | 9 subjecttothepenaltiesofmakingafalseaffidavitordeclaration |
|---|
| 167 | + | 10 andshallbeaccompaniedbytherequiredfee. |
|---|
| 168 | + | 327.314.1.PriortoJanuary1,2024,anypersonmayapply |
|---|
| 169 | + | 2 totheboardforlicensureasaprofessionallandsurveyorwhohas |
|---|
| 170 | + | 3 beenenrolledasalandsurveyor-in-training andhaspresented |
|---|
| 171 | + | 4 evidencetothesatisfactionoftheboardthatsaidpersonhas |
|---|
| 172 | + | 5 acquiredatleastfouryearsofsatisfactoryprofessionalfield |
|---|
| 173 | + | 6 andofficeexperienceinlandsurveyingfromthedateofenrollment |
|---|
| 174 | + | 7 asalandsurveyor-in-training. Thisexperienceshallhavebeen |
|---|
| 175 | + | 8 undertheimmediatepersonalsupervisionofaprofessionalland |
|---|
| 176 | + | 9 surveyor. |
|---|
| 177 | + | 10 2.BeginningJanuary1,2024,anypersonmayapplytothe |
|---|
| 178 | + | 11 boardforlicensurewhopresentsevidencesatisfactorytothe |
|---|
| 179 | + | 12 boardthattheapplicanthasmettherequirementsasprovidedin |
|---|
| 180 | + | 13 thissubsection: |
|---|
| 181 | + | 14 (1)Anapplicantshallbeahighschoolgraduateorholda |
|---|
| 182 | + | 15 certificateofhighschoolequivalence(GED),andeither: |
|---|
| 183 | + | 16 (a)Hasgraduatedandreceivedabaccalaureatedegreeinan |
|---|
| 184 | + | 17 approvedcurriculum,asdefinedbytheboard,whichshallinclude |
|---|
| 185 | + | 18 atleastfifteensemesterhoursofapprovedsurveyingcoursework, |
|---|
| 186 | + | 19 asdefinedbytheboard,ofwhichatleastsixsemesterhoursshall |
|---|
| 187 | + | 20 beinthelegalaspectsofboundarysurveying;or |
|---|
| 188 | + | 21 (b)Haspassedatleastsixtyhoursofcollegecreditwhich |
|---|
| 189 | + | 22 shallincludeatleastfifteensemesterhoursofapproved |
|---|
| 190 | + | 23 surveyingcoursework,asdefinedbytheboard,ofwhichatleast |
|---|
| 191 | + | 24 sixsemesterhoursshallbeinlegalaspectsofboundarysurveying; |
|---|
| 192 | + | 7 25 or |
|---|
| 193 | + | 26 (c)Haspassedatleastfifteensemesterhoursofapproved |
|---|
| 194 | + | 27 surveyingcoursework,asdefinedbytheboard,ofwhichatleast |
|---|
| 195 | + | 28 sixsemesterhoursshallbeinlegalaspectsoflandsurveying; |
|---|
| 196 | + | 29 (d)Anapplicantmeetingtherequirementsofparagraph(a)of |
|---|
| 197 | + | 30 thissubdivisionshallhaveacquiredatleastfouryearsof |
|---|
| 198 | + | 31 satisfactoryfieldandofficeexperienceinlandsurveyingunder |
|---|
| 199 | + | 32 theimmediatepersonalsupervisionofaprofessionalland |
|---|
| 200 | + | 33 surveyor; |
|---|
| 201 | + | 34 (e)Anapplicantmeetingtherequirementsofparagraph(b)of |
|---|
| 202 | + | 35 thissubdivisionshallhaveacquiredatleastfiveyearsof |
|---|
| 203 | + | 36 satisfactoryfieldandofficeexperienceinlandsurveyingunder |
|---|
| 204 | + | 37 theimmediatepersonalsupervisionofaprofessionalland |
|---|
| 205 | + | 38 surveyor; |
|---|
| 206 | + | 39 (f)Anapplicantmeetingtherequirementsofparagraph(c)of |
|---|
| 207 | + | 40 thissubdivisionshallhaveacquiredatleastsixyearsof |
|---|
| 208 | + | 41 satisfactoryfieldandofficeexperienceinlandsurveyingunder |
|---|
| 209 | + | 42 theimmediatepersonalsupervisionofaprofessionalland |
|---|
| 210 | + | 43 surveyor. Pursuanttothisprovision,uptooneyearofpost- |
|---|
| 211 | + | 44 secondaryeducation,approvedbytheboard,maycountas |
|---|
| 212 | + | 45 equivalentworkexperience; |
|---|
| 213 | + | 46 (2)Anapplicantshallpassanyexaminationsrequiredbythe |
|---|
| 214 | + | 47 boardpursuanttosection327.331; |
|---|
| 215 | + | 48 (3)Anypersonenrolledasalandsurveyor-in-training prior |
|---|
| 216 | + | 49 toJanuary1,2024,shallonlyberequiredtomeettherequirements |
|---|
| 217 | + | 50 inplacepursuanttotheirenrollment. |
|---|
| 218 | + | 327.331.1.Afterithasbeendeterminedthatanapplicant |
|---|
| 219 | + | 8 2 possessesthequalificationsentitlingtheapplicanttobe |
|---|
| 220 | + | 3 examined,eachapplicantforexaminationandenrollmentasaland |
|---|
| 221 | + | 4 surveyor-in-training andforexaminationandlicensureasa |
|---|
| 222 | + | 5 professionallandsurveyorinMissourishallappearbeforethe |
|---|
| 223 | + | 6 boardoritsrepresentatives forexaminationatthetimeandplace |
|---|
| 224 | + | 7 specified. |
|---|
| 225 | + | 8 2.Theexaminationorexaminationsshallbeofsuchform, |
|---|
| 226 | + | 9 contentanddurationasshallbedeterminedbytheboardto |
|---|
| 227 | + | 10 thoroughlytestthequalificationsofeachapplicanttobecome |
|---|
| 228 | + | 11 enrolledasaland[surveyor-in-training] surveyor-intern orto |
|---|
| 229 | + | 12 becomelicensedasaprofessionallandsurveyorinMissouri. |
|---|
| 230 | + | 13 3.Anyapplicanttobeeligibleforenrollmentorforlicense |
|---|
| 231 | + | 14 mustmakeagradeontheapplicableexaminationofatleastseventy |
|---|
| 232 | + | 15 percent. |
|---|
| 233 | + | 16 4.Anypersonwhopassestheexaminationhereinabove |
|---|
| 234 | + | 17 specifiedshallbeentitledtobeenrolledasaland[surveyor-in- |
|---|
| 235 | + | 18 training] surveyor-intern orlicensedasaprofessionalland |
|---|
| 236 | + | 19 surveyor,asthecasemaybe,inMissouriandshallreceivea |
|---|
| 237 | + | 20 certificateofenrollmentoralicense,asthecasemaybe. |
|---|
| 238 | + | 332.325.1.TheMissouridentalboardmaycollaboratewith |
|---|
| 239 | + | 2 thedepartmentofhealthandseniorservicesandtheofficeof |
|---|
| 240 | + | 3 dentalhealthwithinthedepartmentofhealthandseniorservices |
|---|
| 241 | + | 4 toapprovepilotprojectsdesignedtoexaminenewmethodsof |
|---|
| 242 | + | 5 extendingcaretomedicallyunderservedpopulations,asdefinedin |
|---|
| 243 | + | 6 42U.S.C.Section300e-1(7). Thesepilotprojectsmayemploy |
|---|
| 244 | + | 7 techniquesorapproachestocarethatmaynecessitateawaiverof |
|---|
| 245 | + | 8 therequirementsofthischapterandregulationspromulgated |
|---|
| 246 | + | 9 9 thereunder;provided: |
|---|
| 247 | + | 10 (1)Theprojectplanhasaclearlystatedobjectiveof |
|---|
| 248 | + | 11 servingaspecificunderservedpopulationthatwarrants,inthe |
|---|
| 249 | + | 12 opinionofamajorityoftheboard,grantingapprovalforapilot |
|---|
| 250 | + | 13 project; |
|---|
| 251 | + | 14 (2)Theprojecthasafinitestartdateandterminationdate; |
|---|
| 252 | + | 15 (3)Theprojectclearlydefinesthenewtechniquesor |
|---|
| 253 | + | 16 approachesitintendstoexaminetodetermineifitresultsinan |
|---|
| 254 | + | 17 improvementinaccessorqualityofcare; |
|---|
| 255 | + | 18 (4)Theprojectplanidentifiesspecificandlimited |
|---|
| 256 | + | 19 locationsandpopulationstoparticipateinthepilotproject; |
|---|
| 257 | + | 20 (5)Theprojectplanclearlyestablishesminimumguidelines |
|---|
| 258 | + | 21 andstandardsforthepilotproject,including,butnotlimitedto, |
|---|
| 259 | + | 22 provisionsforprotectingsafetyofparticipatingpatients; |
|---|
| 260 | + | 23 (6)Theprojectplanclearlydefinesthemeasurement |
|---|
| 261 | + | 24 criteriaitwillusetoevaluatetheoutcomesofthepilotproject |
|---|
| 262 | + | 25 onaccessandqualityofcare;and |
|---|
| 263 | + | 26 (7)Theprojectplanidentifiesreportingintervalsto |
|---|
| 264 | + | 27 communicateinterimandfinaloutcomestotheboard. |
|---|
| 265 | + | 28 2.Theboardmaypromulgaterulesandregulationsto |
|---|
| 266 | + | 29 implementtheprovisionsofthissection.Anyruleorportionofa |
|---|
| 267 | + | 30 rule,asthattermisdefinedinsection536.010,thatiscreated |
|---|
| 268 | + | 31 undertheauthoritydelegatedinthissectionshallbecome |
|---|
| 269 | + | 32 effectiveonlyifitcomplieswithandissubjecttoallofthe |
|---|
| 270 | + | 33 provisionsofchapter536and,ifapplicable,section536.028. |
|---|
| 271 | + | 34 Thissectionandchapter536arenonseverableandifanyofthe |
|---|
| 272 | + | 35 powersvestedwiththegeneralassemblypursuanttochapter536to |
|---|
| 273 | + | 10 36 review,todelaytheeffectivedate,ortodisapproveandannula |
|---|
| 274 | + | 37 rulearesubsequentlyheldunconstitutional, thenthegrantof |
|---|
| 275 | + | 38 rulemakingauthorityandanyruleproposedoradoptedafterAugust |
|---|
| 276 | + | 39 28,2022,shallbeinvalidandvoid. |
|---|
| 277 | + | 40 3.TheprovisionsofthissectionshallexpireonAugust28, |
|---|
| 278 | + | 41 2026.Theboardshallprovideafinalreportonapprovedprojects |
|---|
| 279 | + | 42 andrelateddataorfindingstothegeneralassemblyonorbefore |
|---|
| 280 | + | 43 December31,2025.Thename,location,approvaldates,andgeneral |
|---|
| 281 | + | 44 descriptionofanapprovedpilotprojectshallbedeemedapublic |
|---|
| 282 | + | 45 recordpursuanttochapter610. |
|---|
| 283 | + | 334.100.1.Theboardmayrefusetoissueorrenewany |
|---|
| 284 | + | 2 certificateofregistrationorauthority,permitorlicense |
|---|
| 285 | + | 3 requiredpursuanttothischapterforoneoranycombinationof |
|---|
| 286 | + | 4 causesstatedinsubsection2ofthissection.Theboardshall |
|---|
| 287 | + | 5 notifytheapplicantinwritingofthereasonsfortherefusaland |
|---|
| 288 | + | 6 shalladvisetheapplicantoftheapplicant'srighttofilea |
|---|
| 289 | + | 7 complaintwiththeadministrativehearingcommissionasprovided |
|---|
| 290 | + | 8 bychapter621.Asanalternativetoarefusaltoissueorrenew |
|---|
| 291 | + | 9 anycertificate,registrationorauthority,theboardmay,atits |
|---|
| 292 | + | 10 discretion,issuealicensewhichissubjecttoprobation, |
|---|
| 293 | + | 11 restrictionorlimitationtoanapplicantforlicensureforanyone |
|---|
| 294 | + | 12 oranycombinationofcausesstatedinsubsection2ofthis |
|---|
| 295 | + | 13 section.Theboard'sorderofprobation,limitationor |
|---|
| 296 | + | 14 restrictionshallcontainastatementofthedisciplineimposed, |
|---|
| 297 | + | 15 thebasistherefor,thedatesuchactionshallbecomeeffective, |
|---|
| 298 | + | 16 andastatementthattheapplicanthasthirtydaystorequestin |
|---|
| 299 | + | 17 writingahearingbeforetheadministrativehearingcommission. |
|---|
| 300 | + | 11 18 Iftheboardissuesaprobationary,limitedorrestrictedlicense |
|---|
| 301 | + | 19 toanapplicantforlicensure,eitherpartymayfileawritten |
|---|
| 302 | + | 20 petitionwiththeadministrativehearingcommissionwithinthirty |
|---|
| 303 | + | 21 daysoftheeffectivedateoftheprobationary,limitedor |
|---|
| 304 | + | 22 restrictedlicenseseekingreviewoftheboard'sdetermination. |
|---|
| 305 | + | 23 Ifnowrittenrequestforahearingisreceivedbythe |
|---|
| 306 | + | 24 administrativehearingcommissionwithinthethirty-dayperiod, |
|---|
| 307 | + | 25 therighttoseekreviewoftheboard'sdecisionshallbe |
|---|
| 308 | + | 26 consideredaswaived. |
|---|
| 309 | + | 27 2.Theboardmaycauseacomplainttobefiledwiththe |
|---|
| 310 | + | 28 administrativehearingcommissionasprovidedbychapter621 |
|---|
| 311 | + | 29 againstanyholderofanycertificateofregistrationor |
|---|
| 312 | + | 30 authority,permitorlicenserequiredbythischapteroranyperson |
|---|
| 313 | + | 31 whohasfailedtoreneworhassurrenderedtheperson'scertificate |
|---|
| 314 | + | 32 ofregistrationorauthority,permitorlicenseforanyoneorany |
|---|
| 315 | + | 33 combinationofthefollowingcauses: |
|---|
| 316 | + | 34 (1)Useofanycontrolledsubstance,asdefinedinchapter |
|---|
| 317 | + | 35 195,oralcoholicbeveragetoanextentthatsuchuseimpairsa |
|---|
| 318 | + | 36 person'sabilitytoperformtheworkofanyprofessionlicensedor |
|---|
| 319 | + | 37 regulatedbythischapter; |
|---|
| 320 | + | 38 (2)Thepersonhasbeenfinallyadjudicatedandfoundguilty, |
|---|
| 321 | + | 39 orenteredapleaofguiltyornolocontendere,inacriminal |
|---|
| 322 | + | 40 prosecutionunderthelawsofanystateoroftheUnitedStates, |
|---|
| 323 | + | 41 foranyoffensereasonablyrelatedtothequalifications, |
|---|
| 324 | + | 42 functionsordutiesofanyprofessionlicensedorregulated |
|---|
| 325 | + | 43 pursuanttothischapter,foranyoffenseinvolvingfraud, |
|---|
| 326 | + | 44 dishonestyoranactofviolence,orforanyoffenseinvolving |
|---|
| 327 | + | 12 45 moralturpitude,whetherornotsentenceisimposed; |
|---|
| 328 | + | 46 (3)Useoffraud,deception,misrepresentation orbriberyin |
|---|
| 329 | + | 47 securinganycertificateofregistrationorauthority,permitor |
|---|
| 330 | + | 48 licenseissuedpursuanttothischapterorinobtainingpermission |
|---|
| 331 | + | 49 totakeanyexaminationgivenorrequiredpursuanttothischapter; |
|---|
| 332 | + | 50 (4)Misconduct,fraud,misrepresentation, dishonesty, |
|---|
| 333 | + | 51 unethicalconductorunprofessionalconductintheperformanceof |
|---|
| 334 | + | 52 thefunctionsordutiesofanyprofessionlicensedorregulatedby |
|---|
| 335 | + | 53 thischapter,including,butnotlimitedto,thefollowing: |
|---|
| 336 | + | 54 (a)Obtainingorattemptingtoobtainanyfee,charge, |
|---|
| 337 | + | 55 tuitionorothercompensationbyfraud,deceptionor |
|---|
| 338 | + | 56 misrepresentation; willfullyandcontinuallyoverchargingor |
|---|
| 339 | + | 57 overtreatingpatients;orchargingforvisitstothephysician's |
|---|
| 340 | + | 58 officewhichdidnotoccurunlesstheserviceswerecontractedfor |
|---|
| 341 | + | 59 inadvance,orforserviceswhichwerenotrenderedordocumented |
|---|
| 342 | + | 60 inthepatient'srecords; |
|---|
| 343 | + | 61 (b)Attempting,directlyorindirectly,bywayof |
|---|
| 344 | + | 62 intimidation,coercionordeception,toobtainorretainapatient |
|---|
| 345 | + | 63 ordiscouragetheuseofasecondopinionorconsultation; |
|---|
| 346 | + | 64 (c)Willfullyandcontinuallyperforminginappropriateor |
|---|
| 347 | + | 65 unnecessarytreatment,diagnostictestsormedicalorsurgical |
|---|
| 348 | + | 66 services; |
|---|
| 349 | + | 67 (d)Delegatingprofessionalresponsibilities toapersonwho |
|---|
| 350 | + | 68 isnotqualifiedbytraining,skill,competency,age,experience |
|---|
| 351 | + | 69 orlicensuretoperformsuchresponsibilities; |
|---|
| 352 | + | 70 (e)Misrepresenting thatanydisease,ailmentorinfirmity |
|---|
| 353 | + | 71 canbecuredbyamethod,procedure,treatment,medicineordevice; |
|---|
| 354 | + | 13 72 (f)Performingorprescribingmedicalserviceswhichhave |
|---|
| 355 | + | 73 beendeclaredbyboardruletobeofnomedicalorosteopathic |
|---|
| 356 | + | 74 value; |
|---|
| 357 | + | 75 (g)Finaldisciplinaryactionbyanyprofessionalmedicalor |
|---|
| 358 | + | 76 osteopathicassociationorsocietyorlicensedhospitalormedical |
|---|
| 359 | + | 77 staffofsuchhospitalinthisoranyotherstateorterritory, |
|---|
| 360 | + | 78 whetheragreedtovoluntarilyornot,andincluding,butnot |
|---|
| 361 | + | 79 limitedto,anyremoval,suspension,limitation,orrestrictionof |
|---|
| 362 | + | 80 theperson'slicenseorstafforhospitalprivileges,failureto |
|---|
| 363 | + | 81 renewsuchprivilegesorlicenseforcause,orotherfinal |
|---|
| 364 | + | 82 disciplinaryaction,iftheactionwasinanywayrelatedto |
|---|
| 365 | + | 83 unprofessionalconduct,professionalincompetence,malpracticeor |
|---|
| 366 | + | 84 anyotherviolationofanyprovisionofthischapter; |
|---|
| 367 | + | 85 (h)Signingablankprescriptionform;ordispensing, |
|---|
| 368 | + | 86 prescribing,administeringorotherwisedistributinganydrug, |
|---|
| 369 | + | 87 controlledsubstanceorothertreatmentwithoutsufficient |
|---|
| 370 | + | 88 examinationincludingfailingtoestablishavalidphysician- |
|---|
| 371 | + | 89 patientrelationshippursuanttosection334.108,orforother |
|---|
| 372 | + | 90 thanmedicallyacceptedtherapeuticorexperimentalor |
|---|
| 373 | + | 91 investigativepurposesdulyauthorizedbyastateorfederal |
|---|
| 374 | + | 92 agency,ornotinthecourseofprofessionalpractice,ornotin |
|---|
| 375 | + | 93 goodfaithtorelievepainandsuffering,ornottocurean |
|---|
| 376 | + | 94 ailment,physicalinfirmityordisease,exceptasauthorizedin |
|---|
| 377 | + | 95 section334.104; |
|---|
| 378 | + | 96 (i)Exercisinginfluencewithinaphysician-patient |
|---|
| 379 | + | 97 relationshipforpurposesofengagingapatientinsexual |
|---|
| 380 | + | 98 activity; |
|---|
| 381 | + | 14 99 (j)Beinglistedonanystateorfederalsexualoffender |
|---|
| 382 | + | 100 registry; |
|---|
| 383 | + | 101 (k)Terminatingthemedicalcareofapatientwithout |
|---|
| 384 | + | 102 adequatenoticeorwithoutmakingotherarrangementsforthe |
|---|
| 385 | + | 103 continuedcareofthepatient; |
|---|
| 386 | + | 104 (l)Failingtofurnishdetailsofapatient'smedicalrecords |
|---|
| 387 | + | 105 toothertreatingphysiciansorhospitalsuponproperrequest;or |
|---|
| 388 | + | 106 failingtocomplywithanyotherlawrelatingtomedicalrecords; |
|---|
| 389 | + | 107 (m)Failureofanyapplicantorlicenseetocooperatewith |
|---|
| 390 | + | 108 theboardduringanyinvestigation; |
|---|
| 391 | + | 109 (n)Failuretocomplywithanysubpoenaorsubpoenaduces |
|---|
| 392 | + | 110 tecumfromtheboardoranorderoftheboard; |
|---|
| 393 | + | 111 (o)Failuretotimelypaylicenserenewalfeesspecifiedin |
|---|
| 394 | + | 112 thischapter; |
|---|
| 395 | + | 113 (p)Violatingaprobationagreement,order,orother |
|---|
| 396 | + | 114 settlementagreementwiththisboardoranyotherlicensing |
|---|
| 397 | + | 115 agency; |
|---|
| 398 | + | 116 (q)Failingtoinformtheboardofthephysician'scurrent |
|---|
| 399 | + | 117 residenceandbusinessaddress; |
|---|
| 400 | + | 118 (r)Advertisingbyanapplicantorlicenseewhichisfalseor |
|---|
| 401 | + | 119 misleading,orwhichviolatesanyruleoftheboard,orwhich |
|---|
| 402 | + | 120 claimswithoutsubstantiationthepositivecureofanydisease,or |
|---|
| 403 | + | 121 professionalsuperioritytoorgreaterskillthanthatpossessed |
|---|
| 404 | + | 122 byanyotherphysician. Anapplicantorlicenseeshallalsobein |
|---|
| 405 | + | 123 violationofthisprovisioniftheapplicantorlicenseehasa |
|---|
| 406 | + | 124 financialinterestinanyorganization,corporationorassociation |
|---|
| 407 | + | 125 whichissuesorconductssuchadvertising; |
|---|
| 408 | + | 15 126 (s)Anyotherconductthatisunethicalorunprofessional |
|---|
| 409 | + | 127 involvingaminor; |
|---|
| 410 | + | 128 (5)Anyconductorpracticewhichisormightbeharmfulor |
|---|
| 411 | + | 129 dangeroustothementalorphysicalhealthofapatientorthe |
|---|
| 412 | + | 130 public;orincompetency,grossnegligenceorrepeatednegligence |
|---|
| 413 | + | 131 intheperformanceofthefunctionsordutiesofanyprofession |
|---|
| 414 | + | 132 licensedorregulatedbythischapter.Forthepurposesofthis |
|---|
| 415 | + | 133 subdivision,"repeatednegligence"meansthefailure,onmorethan |
|---|
| 416 | + | 134 oneoccasion,tousethatdegreeofskillandlearningordinarily |
|---|
| 417 | + | 135 usedunderthesameorsimilarcircumstancesbythememberofthe |
|---|
| 418 | + | 136 applicant'sorlicensee'sprofession; |
|---|
| 419 | + | 137 (6)Violationof,orattemptingtoviolate,directlyor |
|---|
| 420 | + | 138 indirectly,orassistingorenablinganypersontoviolate,any |
|---|
| 421 | + | 139 provisionofthischapterorchapter324,orofanylawfulruleor |
|---|
| 422 | + | 140 regulationadoptedpursuanttothischapterorchapter324; |
|---|
| 423 | + | 141 (7)Impersonationofanypersonholdingacertificateof |
|---|
| 424 | + | 142 registrationorauthority,permitorlicenseorallowingany |
|---|
| 425 | + | 143 persontousehisorhercertificateofregistrationorauthority, |
|---|
| 426 | + | 144 permit,licenseordiplomafromanyschool; |
|---|
| 427 | + | 145 (8)Revocation,suspension,restriction,modification, |
|---|
| 428 | + | 146 limitation,reprimand,warning,censure,probationorotherfinal |
|---|
| 429 | + | 147 disciplinaryactionagainsttheholderoforapplicantfora |
|---|
| 430 | + | 148 licenseorotherrighttopracticeanyprofessionregulatedbythis |
|---|
| 431 | + | 149 chapterbyanotherstate,territory,federalagencyorcountry, |
|---|
| 432 | + | 150 whetherornotvoluntarilyagreedtobythelicenseeorapplicant, |
|---|
| 433 | + | 151 including,butnotlimitedto,thedenialoflicensure,surrender |
|---|
| 434 | + | 152 ofthelicense,allowingthelicensetoexpireorlapse,or |
|---|
| 435 | + | 16 153 discontinuingorlimitingthepracticeofmedicinewhilesubject |
|---|
| 436 | + | 154 toaninvestigationorwhileactuallyunderinvestigationbyany |
|---|
| 437 | + | 155 licensingauthority,medicalfacility,branchoftheArmedForces |
|---|
| 438 | + | 156 oftheUnitedStatesofAmerica,insurancecompany,court,agency |
|---|
| 439 | + | 157 ofthestateorfederalgovernment,oremployer; |
|---|
| 440 | + | 158 (9)Apersonisfinallyadjudgedincapacitatedordisabledby |
|---|
| 441 | + | 159 acourtofcompetentjurisdiction; |
|---|
| 442 | + | 160 (10)Assistingorenablinganypersontopracticeorofferto |
|---|
| 443 | + | 161 practiceanyprofessionlicensedorregulatedbythischapterwho |
|---|
| 444 | + | 162 isnotregisteredandcurrentlyeligibletopracticepursuantto |
|---|
| 445 | + | 163 thischapter;orknowinglyperforminganyactwhichinanyway |
|---|
| 446 | + | 164 aids,assists,procures,advises,orencouragesanypersonto |
|---|
| 447 | + | 165 practicemedicinewhoisnotregisteredandcurrentlyeligibleto |
|---|
| 448 | + | 166 practicepursuanttothischapter.Aphysicianwhoworksin |
|---|
| 449 | + | 167 accordancewithstandingordersorprotocolsorinaccordancewith |
|---|
| 450 | + | 168 theprovisionsofsection334.104shallnotbeinviolationofthis |
|---|
| 451 | + | 169 subdivision; |
|---|
| 452 | + | 170 (11)Issuanceofacertificateofregistrationorauthority, |
|---|
| 453 | + | 171 permitorlicensebaseduponamaterialmistakeoffact; |
|---|
| 454 | + | 172 (12)Failuretodisplayavalidcertificateorlicenseifso |
|---|
| 455 | + | 173 requiredbythischapteroranyrulepromulgatedpursuanttothis |
|---|
| 456 | + | 174 chapter; |
|---|
| 457 | + | 175 (13)Violationofthedruglawsorrulesandregulationsof |
|---|
| 458 | + | 176 thisstate,includingbutnotlimitedtoanyprovisionofchapter |
|---|
| 459 | + | 177 195,anyotherstate,orthefederalgovernment; |
|---|
| 460 | + | 178 (14)Knowinglymaking,orcausingtobemade,oraiding,or |
|---|
| 461 | + | 179 abettinginthemakingof,afalsestatementinanybirth,deathor |
|---|
| 462 | + | 17 180 othercertificateordocumentexecutedinconnectionwiththe |
|---|
| 463 | + | 181 practiceoftheperson'sprofession; |
|---|
| 464 | + | 182 (15)Knowinglymakingafalsestatement,orallyorinwriting |
|---|
| 465 | + | 183 totheboard; |
|---|
| 466 | + | 184 (16)Solicitingpatronageinpersonorbyagentsor |
|---|
| 467 | + | 185 representatives, orbyanyothermeansormanner,underthe |
|---|
| 468 | + | 186 person'sownnameorunderthenameofanotherpersonorconcern, |
|---|
| 469 | + | 187 actualorpretended,insuchamannerastoconfuse,deceive,or |
|---|
| 470 | + | 188 misleadthepublicastotheneedornecessityforor |
|---|
| 471 | + | 189 appropriateness ofhealthcareservicesforallpatients,orthe |
|---|
| 472 | + | 190 qualificationsofanindividualpersonorpersonstodiagnose, |
|---|
| 473 | + | 191 render,orperformhealthcareservices; |
|---|
| 474 | + | 192 (17)Using,orpermittingtheuseof,theperson'snameunder |
|---|
| 475 | + | 193 thedesignationof"Doctor","Dr.","M.D.",or"D.O.",orany |
|---|
| 476 | + | 194 similardesignationwithreferencetothecommercialexploitation |
|---|
| 477 | + | 195 ofanygoods,waresormerchandise; |
|---|
| 478 | + | 196 (18)Knowinglymakingorcausingtobemadeafalsestatement |
|---|
| 479 | + | 197 ormisrepresentation ofamaterialfact,withintenttodefraud, |
|---|
| 480 | + | 198 forpaymentpursuanttotheprovisionsofchapter208orchapter |
|---|
| 481 | + | 199 630orforpaymentfromTitleXVIIIorTitleXIXoftheSocial |
|---|
| 482 | + | 200 SecurityAct; |
|---|
| 483 | + | 201 (19)Failureorrefusaltoproperlyguardagainst |
|---|
| 484 | + | 202 contagious,infectiousorcommunicablediseasesorthespread |
|---|
| 485 | + | 203 thereof;maintaininganunsanitaryofficeorperforming |
|---|
| 486 | + | 204 professionalservicesunderunsanitaryconditions;orfailureto |
|---|
| 487 | + | 205 reporttheexistenceofanunsanitaryconditionintheofficeofa |
|---|
| 488 | + | 206 physicianorinanyhealthcarefacilitytotheboard,inwriting, |
|---|
| 489 | + | 18 207 withinthirtydaysafterthediscoverythereof; |
|---|
| 490 | + | 208 (20)Anycandidateforlicensureorpersonlicensedto |
|---|
| 491 | + | 209 practiceasaphysicaltherapist,payingorofferingtopaya |
|---|
| 492 | + | 210 referralfeeor,notwithstanding section334.010tothecontrary, |
|---|
| 493 | + | 211 practicingorofferingtopracticeprofessionalphysicaltherapy |
|---|
| 494 | + | 212 independentoftheprescriptionanddirectionofapersonlicensed |
|---|
| 495 | + | 213 andregisteredasaphysicianandsurgeonpursuanttothischapter, |
|---|
| 496 | + | 214 asadentistpursuanttochapter332,asapodiatristpursuantto |
|---|
| 497 | + | 215 chapter330,asanadvancedpracticeregisterednurseunder |
|---|
| 498 | + | 216 chapter335,oranylicensedandregisteredphysician,dentist, |
|---|
| 499 | + | 217 podiatrist,oradvancedpracticeregisterednursepracticingin |
|---|
| 500 | + | 218 anotherjurisdiction,whoselicenseisingoodstanding; |
|---|
| 501 | + | 219 (21)Anycandidateforlicensureorpersonlicensedto |
|---|
| 502 | + | 220 practiceasaphysicaltherapist,treatingorattemptingtotreat |
|---|
| 503 | + | 221 ailmentsorotherhealthconditionsofhumanbeingsotherthanby |
|---|
| 504 | + | 222 professionalphysicaltherapyandasauthorizedbysections |
|---|
| 505 | + | 223 334.500to334.620; |
|---|
| 506 | + | 224 (22)Anypersonlicensedtopracticeasaphysicianor |
|---|
| 507 | + | 225 surgeon,requiring,asaconditionofthephysician-patient |
|---|
| 508 | + | 226 relationship,thatthepatientreceiveprescribeddrugs,devices |
|---|
| 509 | + | 227 orotherprofessionalservicesdirectlyfromfacilitiesofthat |
|---|
| 510 | + | 228 physician'sofficeorotherentitiesunderthatphysician's |
|---|
| 511 | + | 229 ownershiporcontrol.Aphysicianshallprovidethepatientwitha |
|---|
| 512 | + | 230 prescriptionwhichmaybetakentothefacilityselectedbythe |
|---|
| 513 | + | 231 patientandaphysicianknowinglyfailingtodisclosetoapatient |
|---|
| 514 | + | 232 onaformapprovedbytheadvisorycommissionforprofessional |
|---|
| 515 | + | 233 physicaltherapistsasestablishedbysection334.625whichis |
|---|
| 516 | + | 19 234 datedandsignedbyapatientorguardianacknowledgingthatthe |
|---|
| 517 | + | 235 patientorguardianhasreadandunderstandsthatthephysicianhas |
|---|
| 518 | + | 236 apecuniaryinterestinaphysicaltherapyorrehabilitation |
|---|
| 519 | + | 237 serviceprovidingprescribedtreatmentandthattheprescribed |
|---|
| 520 | + | 238 treatmentisavailableonacompetitivebasis.Thissubdivision |
|---|
| 521 | + | 239 shallnotapplytoareferralbyonephysiciantoanotherphysician |
|---|
| 522 | + | 240 withinagroupofphysicianspracticingtogether; |
|---|
| 523 | + | 241 (23)Apatternofpersonaluseorconsumptionofany |
|---|
| 524 | + | 242 controlledsubstanceunlessitisprescribed,dispensedor |
|---|
| 525 | + | 243 administeredbyanotherphysicianwhoisauthorizedbylawtodo |
|---|
| 526 | + | 244 so; |
|---|
| 527 | + | 245 (24)Habitualintoxicationordependenceonalcohol, |
|---|
| 528 | + | 246 evidenceofwhichmayincludemorethanonealcohol-related |
|---|
| 529 | + | 247 enforcementcontactasdefinedbysection302.525; |
|---|
| 530 | + | 248 (25)Failuretocomplywithatreatmentprogramoran |
|---|
| 531 | + | 249 aftercareprogramenteredintoaspartofaboardorder,settlement |
|---|
| 532 | + | 250 agreementorlicensee'sprofessionalhealthprogram; |
|---|
| 533 | + | 251 (26)Revocation,suspension,limitation,probation,or |
|---|
| 534 | + | 252 restrictionofanykindwhatsoeverofanycontrolledsubstance |
|---|
| 535 | + | 253 authority,whetheragreedtovoluntarilyornot,orvoluntary |
|---|
| 536 | + | 254 terminationofacontrolledsubstanceauthoritywhileunder |
|---|
| 537 | + | 255 investigation; |
|---|
| 538 | + | 256 (27)Foraphysiciantooperate,conduct,manage,or |
|---|
| 539 | + | 257 establishanabortionfacility,orforaphysiciantoperforman |
|---|
| 540 | + | 258 abortioninanabortionfacility,ifsuchfacilitycomesunderthe |
|---|
| 541 | + | 259 definitionofanambulatorysurgicalcenterpursuanttosections |
|---|
| 542 | + | 260 197.200to197.240,andsuchfacilityhasfailedtoobtainorrenew |
|---|
| 543 | + | 20 261 alicenseasanambulatorysurgicalcenter. |
|---|
| 544 | + | 262 3.Collaborativepracticearrangements,protocolsand |
|---|
| 545 | + | 263 standingordersshallbeinwritingandsignedanddatedbya |
|---|
| 546 | + | 264 physicianpriortotheirimplementation. |
|---|
| 547 | + | 265 4.Afterthefilingofsuchcomplaintbeforethe |
|---|
| 548 | + | 266 administrativehearingcommission,theproceedingsshallbe |
|---|
| 549 | + | 267 conductedinaccordancewiththeprovisionsofchapter621.Upona |
|---|
| 550 | + | 268 findingbytheadministrativehearingcommissionthatthegrounds, |
|---|
| 551 | + | 269 providedinsubsection2ofthissection,fordisciplinaryaction |
|---|
| 552 | + | 270 aremet,theboardmay,singlyorincombination,warn,censureor |
|---|
| 553 | + | 271 placethepersonnamedinthecomplaintonprobationonsuchterms |
|---|
| 554 | + | 272 andconditionsastheboarddeemsappropriateforaperiodnotto |
|---|
| 555 | + | 273 exceedtenyears,ormaysuspendtheperson'slicense,certificate |
|---|
| 556 | + | 274 orpermitforaperiodnottoexceedthreeyears,orrestrictor |
|---|
| 557 | + | 275 limittheperson'slicense,certificateorpermitforan |
|---|
| 558 | + | 276 indefiniteperiodoftime,orrevoketheperson'slicense, |
|---|
| 559 | + | 277 certificate,orpermit,oradministerapublicorprivate |
|---|
| 560 | + | 278 reprimand,ordenytheperson'sapplicationforalicense,or |
|---|
| 561 | + | 279 permanentlywithholdissuanceofalicenseorrequirethepersonto |
|---|
| 562 | + | 280 submittothecare,counselingortreatmentofphysicians |
|---|
| 563 | + | 281 designatedbytheboardattheexpenseoftheindividualtobe |
|---|
| 564 | + | 282 examined,orrequirethepersontoattendsuchcontinuing |
|---|
| 565 | + | 283 educationalcoursesandpasssuchexaminationsastheboardmay |
|---|
| 566 | + | 284 direct. |
|---|
| 567 | + | 285 5.Inanyorderofrevocation,theboardmayprovidethatthe |
|---|
| 568 | + | 286 personmaynotapplyforreinstatementoftheperson'slicensefor |
|---|
| 569 | + | 287 aperiodoftimerangingfromtwotosevenyearsfollowingthedate |
|---|
| 570 | + | 21 288 oftheorderofrevocation. Allstayordersshalltollthistime |
|---|
| 571 | + | 289 period. |
|---|
| 572 | + | 290 6.Beforerestoringtogoodstandingalicense,certificate |
|---|
| 573 | + | 291 orpermitissuedpursuanttothischapterwhichhasbeenina |
|---|
| 574 | + | 292 revoked,suspendedorinactivestateforanycauseformorethan |
|---|
| 575 | + | 293 twoyears,theboardmayrequiretheapplicanttoattendsuch |
|---|
| 576 | + | 294 continuingmedicaleducationcoursesandpasssuchexaminationsas |
|---|
| 577 | + | 295 theboardmaydirect. |
|---|
| 578 | + | 296 7.Inanyinvestigation,hearingorotherproceedingto |
|---|
| 579 | + | 297 determinealicensee'sorapplicant'sfitnesstopractice,any |
|---|
| 580 | + | 298 recordrelatingtoanypatientofthelicenseeorapplicantshall |
|---|
| 581 | + | 299 bediscoverablebytheboardandadmissibleintoevidence, |
|---|
| 582 | + | 300 regardlessofanystatutoryorcommonlawprivilegewhichsuch |
|---|
| 583 | + | 301 licensee,applicant,recordcustodianorpatientmightotherwise |
|---|
| 584 | + | 302 invoke.Inaddition,nosuchlicensee,applicant,orrecord |
|---|
| 585 | + | 303 custodianmaywithholdrecordsortestimonybearingupona |
|---|
| 586 | + | 304 licensee'sorapplicant'sfitnesstopracticeonthegroundof |
|---|
| 587 | + | 305 privilegebetweensuchlicensee,applicantorrecordcustodianand |
|---|
| 588 | + | 306 apatient. |
|---|
| 589 | + | 307 8.Theactoflawfullydispensing,prescribing, |
|---|
| 590 | + | 308 administering,orotherwisedistributingivermectintabletsor |
|---|
| 591 | + | 309 hydroxychloroquine sulfatetabletsforhumanuseshallnotbe |
|---|
| 592 | + | 310 groundsfordenial,suspension,revocation,orotherdisciplinary |
|---|
| 593 | + | 311 actionbytheboard. |
|---|
| 594 | + | 334.530.1.Acandidateforlicensetopracticeasa |
|---|
| 595 | + | 2 physicaltherapistshallfurnishevidenceofsuchperson's |
|---|
| 596 | + | 3 educationalqualificationsbysubmittingsatisfactoryevidenceof |
|---|
| 597 | + | 22 4 completionofaprogramofphysicaltherapyeducationapprovedas |
|---|
| 598 | + | 5 reputablebytheboardoreligibilitytograduatefromsucha |
|---|
| 599 | + | 6 programwithinninetydays.Acandidatewhopresentssatisfactory |
|---|
| 600 | + | 7 evidenceoftheperson'sgraduationfromaschoolofphysical |
|---|
| 601 | + | 8 therapyapprovedasreputablebytheAmericanMedicalAssociation |
|---|
| 602 | + | 9 or,ifgraduatedbefore1936,bytheAmericanPhysicalTherapy |
|---|
| 603 | + | 10 Association,orifgraduatedafter1988,theCommissionon |
|---|
| 604 | + | 11 AccreditationforPhysicalTherapyEducationoritssuccessor,is |
|---|
| 605 | + | 12 deemedtohavecompliedwiththeeducationalqualificationsof |
|---|
| 606 | + | 13 thissubsection. |
|---|
| 607 | + | 14 2.Personsdesiringtopracticeasphysicaltherapistsin |
|---|
| 608 | + | 15 thisstateshallappearbeforetheboardatsuchtimeandplaceas |
|---|
| 609 | + | 16 theboardmaydirectandbeexaminedastotheirfitnesstoengage |
|---|
| 610 | + | 17 insuchpractice. Applicantsshallmeetthequalifyingstandards |
|---|
| 611 | + | 18 forsuchexaminations,includinganyrequirementsestablishedby |
|---|
| 612 | + | 19 anyentitycontractedbytheboardtoadministertheboard- |
|---|
| 613 | + | 20 approvedexamination. Applicationsforexaminationshallbein |
|---|
| 614 | + | 21 writing,onaformfurnishedbytheboardandshallinclude |
|---|
| 615 | + | 22 evidencesatisfactorytotheboardthattheapplicantpossesses |
|---|
| 616 | + | 23 thequalificationssetforthinsubsection1ofthissectionand |
|---|
| 617 | + | 24 meetstherequirementsestablishedtoqualifyforexamination. |
|---|
| 618 | + | 25 Eachapplicationshallcontainastatementthatitismadeunder |
|---|
| 619 | + | 26 oathoraffirmationandthatitsrepresentations aretrueand |
|---|
| 620 | + | 27 correcttothebestknowledgeandbeliefoftheapplicant,subject |
|---|
| 621 | + | 28 tothepenaltiesofmakingafalseaffidavitordeclaration. |
|---|
| 622 | + | 29 3.Theexaminationofqualifiedcandidatesforlicensesto |
|---|
| 623 | + | 30 practicephysicaltherapyshalltestentry-levelcompetenceas |
|---|
| 624 | + | 23 31 relatedtophysicaltherapytheory,examinationandevaluation, |
|---|
| 625 | + | 32 physicaltherapydiagnosis,prognosis,treatment,intervention, |
|---|
| 626 | + | 33 prevention,andconsultation. |
|---|
| 627 | + | 34 4.Theexaminationshallembrace,inrelationtothehuman |
|---|
| 628 | + | 35 being,thesubjectsofanatomy,chemistry,kinesiology,pathology, |
|---|
| 629 | + | 36 physics,physiology,psychology,physicaltherapytheoryand |
|---|
| 630 | + | 37 proceduresasrelatedtomedicine,surgeryandpsychiatry,and |
|---|
| 631 | + | 38 suchothersubjects,includingmedicalethics,astheboarddeems |
|---|
| 632 | + | 39 usefultotestthefitnessofthecandidatetopracticephysical |
|---|
| 633 | + | 40 therapy. |
|---|
| 634 | + | 41 5.Nopersonwhohasfailedonsixormoreoccasionsto |
|---|
| 635 | + | 42 achieveapassingscoreontheexaminationrequiredbythissection |
|---|
| 636 | + | 43 shallbeeligibleforlicensurebyexaminationunderthissection. |
|---|
| 637 | + | 44 6.Theapplicantshallpassatestadministeredbytheboard |
|---|
| 638 | + | 45 onthelawsandrulesrelatedtothepracticeofphysicaltherapy |
|---|
| 639 | + | 46 inMissouri. |
|---|
| 640 | + | 334.655.1.Acandidateforlicensuretopracticeasa |
|---|
| 641 | + | 2 physicaltherapistassistantshallfurnishevidenceofthe |
|---|
| 642 | + | 3 person'seducationalqualifications. Theeducationalrequirements |
|---|
| 643 | + | 4 forlicensureasaphysicaltherapistassistantare: |
|---|
| 644 | + | 5 (1)Acertificateofgraduationfromanaccreditedhigh |
|---|
| 645 | + | 6 schooloritsequivalent;and |
|---|
| 646 | + | 7 (2)Satisfactoryevidenceofcompletionofanassociate |
|---|
| 647 | + | 8 degreeprogramofphysicaltherapyeducationaccreditedbythe |
|---|
| 648 | + | 9 commissiononaccreditationofphysicaltherapyeducationor |
|---|
| 649 | + | 10 eligibilitytograduatefromsuchaprogramwithinninetydays. |
|---|
| 650 | + | 11 2.Personsdesiringtopracticeasaphysicaltherapist |
|---|
| 651 | + | 24 12 assistantinthisstateshallappearbeforetheboardatsuchtime |
|---|
| 652 | + | 13 andplaceastheboardmaydirectandbeexaminedastothe |
|---|
| 653 | + | 14 person'sfitnesstoengageinsuchpractice.Applicantsshallmeet |
|---|
| 654 | + | 15 thequalifyingstandardsforsuchexaminations,includingany |
|---|
| 655 | + | 16 requirementsestablishedbyanyentitycontractedbytheboardto |
|---|
| 656 | + | 17 administertheboard-approvedexamination. Applicationsfor |
|---|
| 657 | + | 18 examinationshallbeonaformfurnishedbytheboardandshall |
|---|
| 658 | + | 19 includeevidencesatisfactorytotheboardthattheapplicant |
|---|
| 659 | + | 20 possessesthequalificationsprovidedinsubsection1ofthis |
|---|
| 660 | + | 21 sectionandmeetstherequirementsestablishedtoqualifyfor |
|---|
| 661 | + | 22 examination. Eachapplicationshallcontainastatementthatthe |
|---|
| 662 | + | 23 statementismadeunderoathofaffirmationandthatits |
|---|
| 663 | + | 24 representations aretrueandcorrecttothebestknowledgeand |
|---|
| 664 | + | 25 beliefofthepersonsigningthestatement,subjecttothe |
|---|
| 665 | + | 26 penaltiesofmakingafalseaffidavitordeclaration. |
|---|
| 666 | + | 27 3.Theexaminationofqualifiedcandidatesforlicensureto |
|---|
| 667 | + | 28 practiceasphysicaltherapistassistantsshallembracean |
|---|
| 668 | + | 29 examinationwhichshallcoverthecurriculumtaughtinaccredited |
|---|
| 669 | + | 30 associatedegreeprogramsofphysicaltherapyassistanteducation. |
|---|
| 670 | + | 31 Suchexaminationshallbesufficienttotestthequalificationof |
|---|
| 671 | + | 32 thecandidatesaspractitioners. |
|---|
| 672 | + | 33 4.Theexaminationshallinclude,asrelatedtothehuman |
|---|
| 673 | + | 34 body,thesubjectsofanatomy,kinesiology,pathology,physiology, |
|---|
| 674 | + | 35 psychology,physicaltherapytheoryandproceduresasrelatedto |
|---|
| 675 | + | 36 medicineandsuchothersubjects,includingmedicalethics,asthe |
|---|
| 676 | + | 37 boarddeemsusefultotestthefitnessofthecandidatetopractice |
|---|
| 677 | + | 38 asaphysicaltherapistassistant. |
|---|
| 678 | + | 25 39 5.Nopersonwhohasfailedonsixormoreoccasionsto |
|---|
| 679 | + | 40 achieveapassingscoreontheexaminationrequiredbythissection |
|---|
| 680 | + | 41 shallbeeligibleforlicensurebyexaminationunderthissection. |
|---|
| 681 | + | 42 6.Theapplicantshallpassatestadministeredbytheboard |
|---|
| 682 | + | 43 onthelawsandrulesrelatedtothepracticeasaphysical |
|---|
| 683 | + | 44 therapistassistantinthisstate. |
|---|
| 684 | + | 45 [6.] 7.Theboardshalllicensewithoutexaminationany |
|---|
| 685 | + | 46 legallyqualifiedpersonwhoisaresidentofthisstateandwho |
|---|
| 686 | + | 47 wasactivelyengagedinpracticeasaphysicaltherapistassistant |
|---|
| 687 | + | 48 onAugust28,1993.Theboardmaylicensesuchpersonpursuantto |
|---|
| 688 | + | 49 thissubsectionuntilninetydaysaftertheeffectivedateofthis |
|---|
| 689 | + | 50 section. |
|---|
| 690 | + | 51 [7.] 8.Acandidatetopracticeasaphysicaltherapist |
|---|
| 691 | + | 52 assistantwhodoesnotmeettheeducationalqualificationsmay |
|---|
| 692 | + | 53 submittotheboardanapplicationforexaminationifsuchperson |
|---|
| 693 | + | 54 canfurnishwrittenevidencetotheboardthatthepersonhasbeen |
|---|
| 694 | + | 55 employedinthisstateforatleastthreeofthelastfiveyears |
|---|
| 695 | + | 56 underthesupervisionofalicensedphysicaltherapistandsuch |
|---|
| 696 | + | 57 personpossessestheknowledgeandtrainingequivalenttothat |
|---|
| 697 | + | 58 obtainedinanaccreditedschool.Theboardmaylicensesuch |
|---|
| 698 | + | 59 personspursuanttothissubsectionuntilninetydaysafterrules |
|---|
| 699 | + | 60 developedbythestateboardofhealingartsregardingphysical |
|---|
| 700 | + | 61 therapistassistantlicensingbecomeeffective. |
|---|
| 701 | + | 338.055.1.Theboardmayrefusetoissueanycertificateof |
|---|
| 702 | + | 2 registrationorauthority,permitorlicenserequiredpursuantto |
|---|
| 703 | + | 3 thischapterforoneoranycombinationofcausesstatedin |
|---|
| 704 | + | 4 subsection2ofthissectionorifthedesignatedpharmacist-in- |
|---|
| 705 | + | 26 5 charge,manager-in-charge, oranyofficer,owner,manager,or |
|---|
| 706 | + | 6 controllingshareholderoftheapplicanthascommittedanyactor |
|---|
| 707 | + | 7 practiceinsubsection2ofthissection.Theboardshallnotify |
|---|
| 708 | + | 8 theapplicantinwritingofthereasonsfortherefusalandshall |
|---|
| 709 | + | 9 advisetheapplicantofhisorherrighttofileacomplaintwith |
|---|
| 710 | + | 10 theadministrativehearingcommissionasprovidedbychapter621. |
|---|
| 711 | + | 11 2.Theboardmaycauseacomplainttobefiledwiththe |
|---|
| 712 | + | 12 administrativehearingcommissionasprovidedbychapter621 |
|---|
| 713 | + | 13 againstanyholderofanycertificateofregistrationor |
|---|
| 714 | + | 14 authority,permitorlicenserequiredbythischapteroranyperson |
|---|
| 715 | + | 15 whohasfailedtoreneworhassurrenderedhisorhercertificate |
|---|
| 716 | + | 16 ofregistrationorauthority,permitorlicenseforanyoneorany |
|---|
| 717 | + | 17 combinationofthefollowingcauses: |
|---|
| 718 | + | 18 (1)Useofanycontrolledsubstance,asdefinedinchapter |
|---|
| 719 | + | 19 195,oralcoholicbeveragetoanextentthatsuchuseimpairsa |
|---|
| 720 | + | 20 person'sabilitytoperformtheworkofanyprofessionlicensedor |
|---|
| 721 | + | 21 regulatedbythischapter; |
|---|
| 722 | + | 22 (2)Thepersonhasbeenfinallyadjudicatedandfoundguilty, |
|---|
| 723 | + | 23 orenteredapleaofguiltyornolocontendere,inacriminal |
|---|
| 724 | + | 24 prosecutionunderthelawsofanystateoroftheUnitedStates, |
|---|
| 725 | + | 25 foranyoffensereasonablyrelatedtothequalifications, |
|---|
| 726 | + | 26 functionsordutiesofanyprofessionlicensedorregulatedunder |
|---|
| 727 | + | 27 thischapter,foranyoffenseanessentialelementofwhichis |
|---|
| 728 | + | 28 fraud,dishonestyoranactofviolence,orforanyoffense |
|---|
| 729 | + | 29 involvingmoralturpitude,whetherornotsentenceisimposed; |
|---|
| 730 | + | 30 (3)Useoffraud,deception,misrepresentation orbriberyin |
|---|
| 731 | + | 31 securinganycertificateofregistrationorauthority,permitor |
|---|
| 732 | + | 27 32 licenseissuedpursuanttothischapterorinobtainingpermission |
|---|
| 733 | + | 33 totakeanyexaminationgivenorrequiredpursuanttothischapter; |
|---|
| 734 | + | 34 (4)Obtainingorattemptingtoobtainanyfee,charge, |
|---|
| 735 | + | 35 tuitionorothercompensationbyfraud,deceptionor |
|---|
| 736 | + | 36 misrepresentation; |
|---|
| 737 | + | 37 (5)Incompetence,misconduct,grossnegligence,fraud, |
|---|
| 738 | + | 38 misrepresentation ordishonestyintheperformanceofthe |
|---|
| 739 | + | 39 functionsordutiesofanyprofessionlicensedorregulatedbythis |
|---|
| 740 | + | 40 chapter; |
|---|
| 741 | + | 41 (6)Violationof,orassistingorenablinganypersonto |
|---|
| 742 | + | 42 violate,anyprovisionofthischapter,orofanylawfulruleor |
|---|
| 743 | + | 43 regulationadoptedpursuanttothischapter; |
|---|
| 744 | + | 44 (7)Impersonationofanypersonholdingacertificateof |
|---|
| 745 | + | 45 registrationorauthority,permitorlicenseorallowingany |
|---|
| 746 | + | 46 persontousehisorhercertificateofregistrationorauthority, |
|---|
| 747 | + | 47 permit,license,ordiplomafromanyschool; |
|---|
| 748 | + | 48 (8)Denialoflicensuretoanapplicantordisciplinary |
|---|
| 749 | + | 49 actionagainstanapplicantortheholderofalicenseorother |
|---|
| 750 | + | 50 righttopracticeanyprofessionregulatedbythischaptergranted |
|---|
| 751 | + | 51 byanotherstate,territory,federalagency,orcountrywhetheror |
|---|
| 752 | + | 52 notvoluntarilyagreedtobythelicenseeorapplicant,including, |
|---|
| 753 | + | 53 butnotlimitedto,surrenderofthelicenseupongroundsforwhich |
|---|
| 754 | + | 54 denialordisciplineisauthorizedinthisstate; |
|---|
| 755 | + | 55 (9)Apersonisfinallyadjudgedincapacitatedbyacourtof |
|---|
| 756 | + | 56 competentjurisdiction; |
|---|
| 757 | + | 57 (10)Assistingorenablinganypersontopracticeorofferto |
|---|
| 758 | + | 58 practiceanyprofessionlicensedorregulatedbythischapterwho |
|---|
| 759 | + | 28 59 isnotregisteredandcurrentlyeligibletopracticeunderthis |
|---|
| 760 | + | 60 chapter; |
|---|
| 761 | + | 61 (11)Issuanceofacertificateofregistrationorauthority, |
|---|
| 762 | + | 62 permitorlicensebaseduponamaterialmistakeoffact; |
|---|
| 763 | + | 63 (12)Failuretodisplayavalidcertificateorlicenseifso |
|---|
| 764 | + | 64 requiredbythischapteroranyrulepromulgatedhereunder; |
|---|
| 765 | + | 65 (13)Violationofanyprofessionaltrustorconfidence; |
|---|
| 766 | + | 66 (14)Useofanyadvertisementorsolicitationwhichisfalse, |
|---|
| 767 | + | 67 misleadingordeceptivetothegeneralpublicorpersonstowhom |
|---|
| 768 | + | 68 theadvertisementorsolicitationisprimarilydirected; |
|---|
| 769 | + | 69 (15)Violationofthedruglawsorrulesandregulationsof |
|---|
| 770 | + | 70 thisstate,anyotherstateorthefederalgovernment; |
|---|
| 771 | + | 71 (16)Theintentionalactofsubstitutingorotherwise |
|---|
| 772 | + | 72 changingthecontent,formulaorbrandofanydrugprescribedby |
|---|
| 773 | + | 73 written,electronic,ororalprescriptionwithoutpriorwrittenor |
|---|
| 774 | + | 74 oralapprovalfromtheprescriberfortherespectivechangeineach |
|---|
| 775 | + | 75 prescription;provided,however,thatnothingcontainedherein |
|---|
| 776 | + | 76 shallprohibitapharmacistfromsubstitutingorchangingthe |
|---|
| 777 | + | 77 brandofanydrugasprovidedundersection338.056,andanysuch |
|---|
| 778 | + | 78 substitutingorchangingofthebrandofanydrugasprovidedfor |
|---|
| 779 | + | 79 insection338.056shallnotbedeemedunprofessionalor |
|---|
| 780 | + | 80 dishonorableconductunlessaviolationofsection338.056occurs; |
|---|
| 781 | + | 81 (17)Personaluseorconsumptionofanycontrolledsubstance |
|---|
| 782 | + | 82 unlessitisprescribed,dispensed,oradministeredbyahealth |
|---|
| 783 | + | 83 careproviderwhoisauthorizedbylawtodoso. |
|---|
| 784 | + | 84 3.Afterthefilingofsuchcomplaint,theproceedingsshall |
|---|
| 785 | + | 85 beconductedinaccordancewiththeprovisionsofchapter621. |
|---|
| 786 | + | 29 86 Uponafindingbytheadministrativehearingcommissionthatthe |
|---|
| 787 | + | 87 grounds,providedinsubsection2ofthissection,for |
|---|
| 788 | + | 88 disciplinaryactionaremet,theboardmay,singlyorin |
|---|
| 789 | + | 89 combination,censureorplacethepersonnamedinthecomplainton |
|---|
| 790 | + | 90 probationonsuchtermsandconditionsastheboarddeems |
|---|
| 791 | + | 91 appropriateforaperiodnottoexceedfiveyears,ormaysuspend, |
|---|
| 792 | + | 92 foraperiodnottoexceedthreeyears,orrevokethelicense, |
|---|
| 793 | + | 93 certificate,orpermit.Theboardmayimposeadditional |
|---|
| 794 | + | 94 disciplineonalicensee,registrant,orpermitteefoundtohave |
|---|
| 795 | + | 95 violatedanydisciplinarytermspreviouslyimposedunderthis |
|---|
| 796 | + | 96 sectionorbyagreement. Theadditionaldisciplinemayinclude, |
|---|
| 797 | + | 97 singlyorincombination,censure,placingthelicensee, |
|---|
| 798 | + | 98 registrant,orpermitteenamedinthecomplaintonadditional |
|---|
| 799 | + | 99 probationonsuchtermsandconditionsastheboarddeems |
|---|
| 800 | + | 100 appropriate,whichadditionalprobationshallnotexceedfive |
|---|
| 801 | + | 101 years,orsuspensionforaperiodnottoexceedthreeyears,or |
|---|
| 802 | + | 102 revocationofthelicense,certificate,orpermit. |
|---|
| 803 | + | 103 4.Iftheboardconcludesthatalicenseeorregistranthas |
|---|
| 804 | + | 104 committedanactorisengaginginacourseofconductwhichwould |
|---|
| 805 | + | 105 begroundsfordisciplinaryactionwhichconstitutesaclearand |
|---|
| 806 | + | 106 presentdangertothepublichealthandsafety,theboardmayfile |
|---|
| 807 | + | 107 acomplaintbeforetheadministrativehearingcommission |
|---|
| 808 | + | 108 requestinganexpeditedhearingandspecifyingtheactivities |
|---|
| 809 | + | 109 whichgiverisetothedangerandthenatureoftheproposed |
|---|
| 810 | + | 110 restrictionorsuspensionofthelicensee'sorregistrant's |
|---|
| 811 | + | 111 license.Withinfifteendaysafterserviceofthecomplaintonthe |
|---|
| 812 | + | 112 licenseeorregistrant,theadministrativehearingcommission |
|---|
| 813 | + | 30 113 shallconductapreliminaryhearingtodeterminewhetherthe |
|---|
| 814 | + | 114 allegedactivitiesofthelicenseeorregistrantappearto |
|---|
| 815 | + | 115 constituteaclearandpresentdangertothepublichealthand |
|---|
| 816 | + | 116 safetywhichjustifythatthelicensee'sorregistrant'slicense |
|---|
| 817 | + | 117 orregistrationbeimmediatelyrestrictedorsuspended. The |
|---|
| 818 | + | 118 burdenofprovingthattheactionsofalicenseeorregistrant |
|---|
| 819 | + | 119 constituteaclearandpresentdangertothepublichealthand |
|---|
| 820 | + | 120 safetyshallbeuponthestateboardofpharmacy. The |
|---|
| 821 | + | 121 administrativehearingcommissionshallissueitsdecision |
|---|
| 822 | + | 122 immediatelyafterthehearingandshalleithergranttotheboard |
|---|
| 823 | + | 123 theauthoritytosuspendorrestrictthelicenseordismissthe |
|---|
| 824 | + | 124 action. |
|---|
| 825 | + | 125 5.Iftheadministrativehearingcommissiongrantstemporary |
|---|
| 826 | + | 126 authoritytotheboardtorestrictorsuspendthelicensee'sor |
|---|
| 827 | + | 127 registrant'slicense,suchtemporaryauthorityoftheboardshall |
|---|
| 828 | + | 128 becomefinalauthorityifthereisnorequestbythelicenseeor |
|---|
| 829 | + | 129 registrantforafullhearingwithinthirtydaysofthepreliminary |
|---|
| 830 | + | 130 hearing.Theadministrativehearingcommissionshall,if |
|---|
| 831 | + | 131 requestedbythelicenseeorregistrantnamedinthecomplaint,set |
|---|
| 832 | + | 132 adatetoholdafullhearingundertheprovisionsofchapter621 |
|---|
| 833 | + | 133 regardingtheactivitiesallegedintheinitialcomplaintfiledby |
|---|
| 834 | + | 134 theboard. |
|---|
| 835 | + | 135 6.Iftheadministrativehearingcommissiondismissesthe |
|---|
| 836 | + | 136 actionfiledbytheboardpursuanttosubsection4ofthissection, |
|---|
| 837 | + | 137 suchdismissalshallnotbartheboardfrominitiatingasubsequent |
|---|
| 838 | + | 138 actiononthesamegrounds. |
|---|
| 839 | + | 139 7.Theboardshallnotdeny,revoke,orsuspend,orotherwise |
|---|
| 840 | + | 31 140 takeanydisciplinaryactionagainst,acertificateof |
|---|
| 841 | + | 141 registrationorauthority,permit,orlicenserequiredbythis |
|---|
| 842 | + | 142 chapterforanypersonduetothelawfuldispensing,distributing, |
|---|
| 843 | + | 143 orsellingofivermectintabletsorhydroxychloroquine sulfate |
|---|
| 844 | + | 144 tabletsforhumanuseinaccordancewithprescriberdirections. A |
|---|
| 845 | + | 145 pharmacistshallnotcontacttheprescribingphysicianorthe |
|---|
| 846 | + | 146 patienttodisputetheefficacyofivermectintabletsor |
|---|
| 847 | + | 147 hydroxychloroquine sulfatetabletsforhumanuseunlessthe |
|---|
| 848 | + | 148 physicianorpatientinquiresofthepharmacistabouttheefficacy |
|---|
| 849 | + | 149 ofivermectintabletsorhydroxychloroquine sulfatetablets. |
|---|
| 850 | + | 345.015.Asusedinsections345.010to345.080,the |
|---|
| 851 | + | 2 followingtermsmean: |
|---|
| 852 | + | 3 (1)"Audiologist",apersonwhoislicensedasanaudiologist |
|---|
| 853 | + | 4 pursuanttosections345.010to345.080topracticeaudiology; |
|---|
| 854 | + | 5 (2)"Audiologyaide",apersonwhoisregisteredasan |
|---|
| 855 | + | 6 audiologyaidebytheboard,whodoesnotactindependentlybut |
|---|
| 856 | + | 7 worksunderthedirectionandsupervisionofalicensed |
|---|
| 857 | + | 8 audiologist. Suchpersonassiststheaudiologistwithactivities |
|---|
| 858 | + | 9 whichrequireanunderstandingofaudiologybutdonotrequire |
|---|
| 859 | + | 10 formaltrainingintherelevantacademics. Tobeeligiblefor |
|---|
| 860 | + | 11 registrationbytheboard,eachapplicantshallsubmita |
|---|
| 861 | + | 12 registrationfeeand: |
|---|
| 862 | + | 13 (a)Beatleasteighteenyearsofage; |
|---|
| 863 | + | 14 (b)Furnishevidenceoftheperson'seducational |
|---|
| 864 | + | 15 qualificationswhichshallbeataminimum: |
|---|
| 865 | + | 16 a.Certificationofgraduationfromanaccreditedhigh |
|---|
| 866 | + | 17 schooloritsequivalent;and |
|---|
| 867 | + | 32 18 b.On-the-jobtraining; |
|---|
| 868 | + | 19 (c)Beemployedinasettinginwhichdirectandindirect |
|---|
| 869 | + | 20 supervisionareprovidedonaregularandsystematicbasisbya |
|---|
| 870 | + | 21 licensedaudiologist. |
|---|
| 871 | + | 22 |
|---|
| 872 | + | 23 However,theaideshallnotadministerorinterprethearing |
|---|
| 873 | + | 24 screeningordiagnostictests,fitordispensehearing |
|---|
| 874 | + | 25 instruments,makeearimpressions,makediagnosticstatements, |
|---|
| 875 | + | 26 determinecaseselection,presentwrittenreportstoanyoneother |
|---|
| 876 | + | 27 thanthesupervisorwithoutthesignatureofthesupervisor,make |
|---|
| 877 | + | 28 referralstootherprofessionalsoragencies,useatitleother |
|---|
| 878 | + | 29 thanaudiologyaide,developormodifytreatmentplans,discharge |
|---|
| 879 | + | 30 clientsfromtreatmentorterminatetreatment,discloseclinical |
|---|
| 880 | + | 31 information,eitherorallyorinwriting,toanyoneotherthanthe |
|---|
| 881 | + | 32 supervisingaudiologist,orperformanyprocedureforwhichheor |
|---|
| 882 | + | 33 sheisnotqualified,hasnotbeenadequatelytrainedorboth; |
|---|
| 883 | + | 34 (3)"Board",thestateboardofregistrationforthehealing |
|---|
| 884 | + | 35 arts; |
|---|
| 885 | + | 36 (4)"Clinicalfellowship",thesupervisedprofessional |
|---|
| 886 | + | 37 employmentperiodfollowingcompletionoftheacademicand |
|---|
| 887 | + | 38 practicumrequirementsofanaccreditedtrainingprogramunder |
|---|
| 888 | + | 39 thischapter; |
|---|
| 889 | + | 40 (5)"Commission",theadvisorycommissionforspeech- |
|---|
| 890 | + | 41 languagepathologistsandaudiologists; |
|---|
| 891 | + | 42 [(5)] (6)"Hearinginstrument"or"hearingaid",any |
|---|
| 892 | + | 43 wearabledeviceorinstrumentdesignedfororofferedforthe |
|---|
| 893 | + | 44 purposeofaidingorcompensatingforimpairedhumanhearingand |
|---|
| 894 | + | 33 45 anyparts,attachmentsoraccessories,includingearmolds,but |
|---|
| 895 | + | 46 excludingbatteries,cords,receiversandrepairs; |
|---|
| 896 | + | 47 [(6)] (7)"Person",anyindividual,organization,or |
|---|
| 897 | + | 48 corporatebody,exceptthatonlyindividualsmaybelicensed |
|---|
| 898 | + | 49 pursuanttosections345.010to345.080; |
|---|
| 899 | + | 50 [(7)] (8)"Practiceofaudiology": |
|---|
| 900 | + | 51 (a)Theapplicationofacceptedaudiologicprinciples, |
|---|
| 901 | + | 52 methodsandproceduresforthemeasurement,testing, |
|---|
| 902 | + | 53 interpretation, appraisalandpredictionrelatedtodisordersof |
|---|
| 903 | + | 54 theauditorysystem,balancesystemorrelatedstructuresand |
|---|
| 904 | + | 55 systems; |
|---|
| 905 | + | 56 (b)Providesconsultationorcounselingtothepatient, |
|---|
| 906 | + | 57 client,student,theirfamilyorinterestedparties; |
|---|
| 907 | + | 58 (c)Providesacademic,socialandmedicalreferralswhen |
|---|
| 908 | + | 59 appropriate; |
|---|
| 909 | + | 60 (d)Providesforestablishinggoals,implementing |
|---|
| 910 | + | 61 strategies,methodsandtechniques,forhabilitation, |
|---|
| 911 | + | 62 rehabilitationorauralrehabilitation, relatedtodisordersof |
|---|
| 912 | + | 63 theauditorysystem,balancesystemorrelatedstructuresand |
|---|
| 913 | + | 64 systems; |
|---|
| 914 | + | 65 (e)Providesforinvolvementinrelatedresearch,teaching |
|---|
| 915 | + | 66 orpubliceducation; |
|---|
| 916 | + | 67 (f)Providesforrenderingofservicesorparticipatesinthe |
|---|
| 917 | + | 68 planning,directingorconductingofprogramswhicharedesigned |
|---|
| 918 | + | 69 tomodifyaudition,communicative,balanceorcognitivedisorder, |
|---|
| 919 | + | 70 whichmayinvolvespeechandlanguageoreducationissues; |
|---|
| 920 | + | 71 (g)Providesandinterpretsbehavioralandneurophysiologic |
|---|
| 921 | + | 34 72 measurementsofauditorybalance,cognitiveprocessingandrelated |
|---|
| 922 | + | 73 functions,includingintraoperativemonitoring; |
|---|
| 923 | + | 74 (h)Providesinvolvementinanytasks,procedures,actsor |
|---|
| 924 | + | 75 practicesthatarenecessaryforevaluationofaudition,hearing, |
|---|
| 925 | + | 76 trainingintheuseofamplificationorassistivelistening |
|---|
| 926 | + | 77 devices; |
|---|
| 927 | + | 78 (i)Providesselection,assessment,fitting,programming, |
|---|
| 928 | + | 79 anddispensingofhearinginstruments,assistivelistening |
|---|
| 929 | + | 80 devices,andotheramplificationsystems; |
|---|
| 930 | + | 81 (j)Providesfortakingimpressionsoftheear,makingcustom |
|---|
| 931 | + | 82 earmolds,earplugs,swimmoldsandindustrialnoiseprotectors; |
|---|
| 932 | + | 83 (k)Providesassessmentofexternalearandcerumen |
|---|
| 933 | + | 84 management; |
|---|
| 934 | + | 85 (l)Providesadvising,fitting,mappingassessmentof |
|---|
| 935 | + | 86 implantabledevicessuchascochlearorauditorybrainstem |
|---|
| 936 | + | 87 devices; |
|---|
| 937 | + | 88 (m)Providesinformationinnoisecontrolandhearing |
|---|
| 938 | + | 89 conservationincludingeducation,equipmentselection,equipment |
|---|
| 939 | + | 90 calibration,siteevaluationandemployeeevaluation; |
|---|
| 940 | + | 91 (n)Providesperformingbasicspeech-language screening |
|---|
| 941 | + | 92 test; |
|---|
| 942 | + | 93 (o)Providesinvolvementinsocialaspectsofcommunication, |
|---|
| 943 | + | 94 includingchallengingbehaviorandineffectivesocialskills,lack |
|---|
| 944 | + | 95 ofcommunicationopportunities; |
|---|
| 945 | + | 96 (p)Providessupportandtrainingoffamilymembersandother |
|---|
| 946 | + | 97 communicationpartnersfortheindividualwithauditorybalance, |
|---|
| 947 | + | 98 cognitiveandcommunicationdisorders; |
|---|
| 948 | + | 35 99 (q)Providesauralrehabilitationandrelatedservicesto |
|---|
| 949 | + | 100 individualswithhearinglossandtheirfamilies; |
|---|
| 950 | + | 101 (r)Evaluates,collaboratesandmanagesauditionproblemsin |
|---|
| 951 | + | 102 theassessmentofthecentralauditoryprocessingdisordersand |
|---|
| 952 | + | 103 providinginterventionforindividualswithcentralauditory |
|---|
| 953 | + | 104 processingdisorders; |
|---|
| 954 | + | 105 (s)Developsandmanagesacademicandclinicalproblemsin |
|---|
| 955 | + | 106 communicationsciencesanddisorders; |
|---|
| 956 | + | 107 (t)Conducts,disseminatesandappliesresearchin |
|---|
| 957 | + | 108 communicationsciencesanddisorders; |
|---|
| 958 | + | 109 [(8)] (9)"Practiceofspeech-language pathology": |
|---|
| 959 | + | 110 (a)Providesscreening,identification, assessment, |
|---|
| 960 | + | 111 diagnosis,treatment,intervention,includingbutnotlimitedto |
|---|
| 961 | + | 112 prevention,restoration,ameliorationandcompensation,and |
|---|
| 962 | + | 113 follow-upservicesfordisordersof: |
|---|
| 963 | + | 114 a.Speech:articulation,fluency,voice,including |
|---|
| 964 | + | 115 respiration,phonationandresonance; |
|---|
| 965 | + | 116 b.Language,involvingtheparametersofphonology, |
|---|
| 966 | + | 117 morphology,syntax,semanticsandpragmatic;andincluding |
|---|
| 967 | + | 118 disordersofreceptiveandexpressivecommunicationinoral, |
|---|
| 968 | + | 119 written,graphicandmanualmodalities; |
|---|
| 969 | + | 120 c.Oral,pharyngeal,cervicalesophagealandrelated |
|---|
| 970 | + | 121 functions,suchasdysphagia,includingdisordersofswallowing |
|---|
| 971 | + | 122 andoralfunctionsforfeeding;orofacialmyofunctionaldisorders; |
|---|
| 972 | + | 123 d.Cognitiveaspectsofcommunication,including |
|---|
| 973 | + | 124 communicationdisabilityandotherfunctionaldisabilities |
|---|
| 974 | + | 125 associatedwithcognitiveimpairment; |
|---|
| 975 | + | 36 126 e.Socialaspectsofcommunication,includingchallenging |
|---|
| 976 | + | 127 behavior,ineffectivesocialskills,lackofcommunication |
|---|
| 977 | + | 128 opportunities; |
|---|
| 978 | + | 129 (b)Providesconsultationandcounselingandmakesreferrals |
|---|
| 979 | + | 130 whenappropriate; |
|---|
| 980 | + | 131 (c)Trainsandsupportsfamilymembersandother |
|---|
| 981 | + | 132 communicationpartnersofindividualswithspeech,voice, |
|---|
| 982 | + | 133 language,communicationandswallowingdisabilities; |
|---|
| 983 | + | 134 (d)Developsandestablisheseffectiveaugmentativeand |
|---|
| 984 | + | 135 alternativecommunicationtechniquesandstrategies,including |
|---|
| 985 | + | 136 selecting,prescribinganddispensingofaugmentativeaidsand |
|---|
| 986 | + | 137 devices;andthetrainingofindividuals,theirfamiliesandother |
|---|
| 987 | + | 138 communicationpartnersintheiruse; |
|---|
| 988 | + | 139 (e)Selects,fitsandestablisheseffectiveuseof |
|---|
| 989 | + | 140 appropriateprosthetic/adaptive devicesforspeakingand |
|---|
| 990 | + | 141 swallowing,suchastracheoesophageal valves,electrolarynges, or |
|---|
| 991 | + | 142 speakingvalves; |
|---|
| 992 | + | 143 (f)Usesinstrumentaltechnologytodiagnoseandtreat |
|---|
| 993 | + | 144 disordersofcommunicationandswallowing,suchas |
|---|
| 994 | + | 145 videofluoroscopy, nasendoscopy,ultrasonography andstroboscopy; |
|---|
| 995 | + | 146 (g)Providesauralrehabilitativeandrelatedcounseling |
|---|
| 996 | + | 147 servicestoindividualswithhearinglossandtotheirfamilies; |
|---|
| 997 | + | 148 (h)Collaboratesintheassessmentofcentralauditory |
|---|
| 998 | + | 149 processingdisordersincasesinwhichthereisevidenceofspeech, |
|---|
| 999 | + | 150 languageorothercognitivecommunicationdisorders;provides |
|---|
| 1000 | + | 151 interventionforindividualswithcentralauditoryprocessing |
|---|
| 1001 | + | 152 disorders; |
|---|
| 1002 | + | 37 153 (i)Conductspure-toneairconductionhearingscreeningand |
|---|
| 1003 | + | 154 screeningtympanometryforthepurposeoftheinitial |
|---|
| 1004 | + | 155 identificationorreferral; |
|---|
| 1005 | + | 156 (j)Enhancesspeechandlanguageproficiencyand |
|---|
| 1006 | + | 157 communicationeffectiveness,includingbutnotlimitedtoaccent |
|---|
| 1007 | + | 158 reduction,collaborationwithteachersofEnglishasasecond |
|---|
| 1008 | + | 159 languageandimprovementofvoice,performanceandsinging; |
|---|
| 1009 | + | 160 (k)Trainsandsupervisessupportpersonnel; |
|---|
| 1010 | + | 161 (l)Developsandmanagesacademicandclinicalprogramsin |
|---|
| 1011 | + | 162 communicationsciencesanddisorders; |
|---|
| 1012 | + | 163 (m)Conducts,disseminatesandappliesresearchin |
|---|
| 1013 | + | 164 communicationsciencesanddisorders; |
|---|
| 1014 | + | 165 (n)Measuresoutcomesoftreatmentandconductscontinuous |
|---|
| 1015 | + | 166 evaluationoftheeffectivenessofpracticesandprogramsto |
|---|
| 1016 | + | 167 improveandmaintainqualityofservices; |
|---|
| 1017 | + | 168 [(9)] (10)"Speech-language pathologist",apersonwhois |
|---|
| 1018 | + | 169 licensedasaspeech-language pathologistpursuanttosections |
|---|
| 1019 | + | 170 345.010to345.080;whoengagesinthepracticeofspeech-language |
|---|
| 1020 | + | 171 pathologyasdefinedinsections345.010to345.080; |
|---|
| 1021 | + | 172 [(10)] (11)"Speech-language pathologyaide",apersonwho |
|---|
| 1022 | + | 173 isregisteredasaspeech-language aidebytheboard,whodoesnot |
|---|
| 1023 | + | 174 actindependentlybutworksunderthedirectionandsupervisionof |
|---|
| 1024 | + | 175 alicensedspeech-language pathologist. Suchpersonassiststhe |
|---|
| 1025 | + | 176 speech-language pathologistwithactivitieswhichrequirean |
|---|
| 1026 | + | 177 understandingofspeech-language pathologybutdonotrequire |
|---|
| 1027 | + | 178 formaltrainingintherelevantacademics. Tobeeligiblefor |
|---|
| 1028 | + | 179 registrationbytheboard,eachapplicantshallsubmita |
|---|
| 1029 | + | 38 180 registrationfeeand: |
|---|
| 1030 | + | 181 (a)Beatleasteighteenyearsofage; |
|---|
| 1031 | + | 182 (b)Furnishevidenceoftheperson'seducational |
|---|
| 1032 | + | 183 qualificationswhichshallbeataminimum: |
|---|
| 1033 | + | 184 a.Certificationofgraduationfromanaccreditedhigh |
|---|
| 1034 | + | 185 schooloritsequivalent;and |
|---|
| 1035 | + | 186 b.On-the-jobtraining; |
|---|
| 1036 | + | 187 (c)Beemployedinasettinginwhichdirectandindirect |
|---|
| 1037 | + | 188 supervisionisprovidedonaregularandsystematicbasisbya |
|---|
| 1038 | + | 189 licensedspeech-language pathologist. |
|---|
| 1039 | + | 190 |
|---|
| 1040 | + | 191 However,theaideshallnotadministerorinterprethearing |
|---|
| 1041 | + | 192 screeningordiagnostictests,fitordispensehearing |
|---|
| 1042 | + | 193 instruments,makeearimpressions,makediagnosticstatements, |
|---|
| 1043 | + | 194 determinecaseselection,presentwrittenreportstoanyoneother |
|---|
| 1044 | + | 195 thanthesupervisorwithoutthesignatureofthesupervisor,make |
|---|
| 1045 | + | 196 referralstootherprofessionalsoragencies,useatitleother |
|---|
| 1046 | + | 197 thanspeech-language pathologyaide,developormodifytreatment |
|---|
| 1047 | + | 198 plans,dischargeclientsfromtreatmentorterminatetreatment, |
|---|
| 1048 | + | 199 discloseclinicalinformation,eitherorallyorinwriting,to |
|---|
| 1049 | + | 200 anyoneotherthanthesupervisingspeech-language pathologist,or |
|---|
| 1050 | + | 201 performanyprocedureforwhichheorsheisnotqualified,hasnot |
|---|
| 1051 | + | 202 beenadequatelytrainedorboth; |
|---|
| 1052 | + | 203 [(11)] (12)"Speech-language pathologyassistant",aperson |
|---|
| 1053 | + | 204 whoisregisteredasaspeech-language pathologyassistantbythe |
|---|
| 1054 | + | 205 board,whodoesnotactindependentlybutworksunderthedirection |
|---|
| 1055 | + | 206 andsupervisionofalicensedspeech-language pathologist |
|---|
| 1056 | + | 39 207 practicingforatleastoneyearorspeech-language pathologist |
|---|
| 1057 | + | 208 practicingundersubdivision(1)or(6)ofsubsection1ofsection |
|---|
| 1058 | + | 209 345.025foratleastoneyearandwhoseactivitiesrequireboth |
|---|
| 1059 | + | 210 academicandpracticaltraininginthefieldofspeech-language |
|---|
| 1060 | + | 211 pathologyalthoughlesstrainingthanthoseestablishedby |
|---|
| 1061 | + | 212 sections345.010to345.080asnecessaryforlicensingasaspeech- |
|---|
| 1062 | + | 213 languagepathologist. Tobeeligibleforregistrationbythe |
|---|
| 1063 | + | 214 board,eachapplicantshallsubmittheregistrationfee, |
|---|
| 1064 | + | 215 supervisingspeech-language pathologistinformationifemployment |
|---|
| 1065 | + | 216 isconfirmed,ifnotsuchinformationshallbeprovidedafter |
|---|
| 1066 | + | 217 registration,andfurnishevidenceoftheperson'seducational |
|---|
| 1067 | + | 218 qualificationswhichmeetthefollowing: |
|---|
| 1068 | + | 219 (a)Holdabachelor'sleveldegreefromaninstitution |
|---|
| 1069 | + | 220 accreditedorapprovedbyaregionalaccreditingbodyrecognized |
|---|
| 1070 | + | 221 bytheUnitedStatesDepartmentofEducationoritsequivalent;and |
|---|
| 1071 | + | 222 (b)Submitofficialtranscriptsfromoneormoreaccredited |
|---|
| 1072 | + | 223 collegesoruniversitiespresentingevidenceofthecompletionof |
|---|
| 1073 | + | 224 bachelor'slevelcourseworkandrequirementsinthefieldof |
|---|
| 1074 | + | 225 speech-language pathologyasestablishedbytheboardthrough |
|---|
| 1075 | + | 226 rulesandregulations; |
|---|
| 1076 | + | 227 (c)Submitproofofcompletionofthenumberandtypeof |
|---|
| 1077 | + | 228 clinicalhoursasestablishedbytheboardthroughrulesand |
|---|
| 1078 | + | 229 regulations. |
|---|
| 1079 | + | 345.022.1.Anypersonintheperson'sclinicalfellowship |
|---|
| 1080 | + | 2 shallholdaprovisionallicensetopracticespeech-language |
|---|
| 1081 | + | 3 pathologyoraudiology. Theboardmayissueaprovisionallicense |
|---|
| 1082 | + | 4 toanapplicantwho: |
|---|
| 1083 | + | 40 5 (1)Hasmettherequirementsforpracticumandacademic |
|---|
| 1084 | + | 6 requirementsfromanaccreditedtrainingprogramunderthis |
|---|
| 1085 | + | 7 chapter; |
|---|
| 1086 | + | 8 (2)Submitsanapplicationtotheboardonaformprescribed |
|---|
| 1087 | + | 9 bytheboard.Suchformshallincludeaplanforthecontentand |
|---|
| 1088 | + | 10 supervisionoftheclinicalfellowship,aswellasevidenceofgood |
|---|
| 1089 | + | 11 moralandethicalcharacter;and |
|---|
| 1090 | + | 12 (3)Submitstotheboardanapplicationfee,assetbythe |
|---|
| 1091 | + | 13 board,fortheprovisionallicense. |
|---|
| 1092 | + | 14 2.Aprovisionallicenseiseffectiveforoneyearandmaybe |
|---|
| 1093 | + | 15 extendedforanadditionaltwelvemonthsonlyforpurposesof |
|---|
| 1094 | + | 16 completingthepostgraduateclinicalexperienceportionofthe |
|---|
| 1095 | + | 17 clinicalfellowship;provided,thattheapplicanthaspassedthe |
|---|
| 1096 | + | 18 nationalexaminationandshallholdamaster'sdegreefroman |
|---|
| 1097 | + | 19 approvedtrainingprograminhisorherareaofapplication. |
|---|
| 1098 | + | 20 3.Withintwelvemonthsofissuanceoftheprovisional |
|---|
| 1099 | + | 21 license,theapplicantshallpassanexaminationpromulgatedor |
|---|
| 1100 | + | 22 approvedbytheboard. |
|---|
| 1101 | + | 23 4.Withintwelvemonthsofissuanceofaprovisionallicense, |
|---|
| 1102 | + | 24 theapplicantshallcompletetherequirementsforthemaster'sor |
|---|
| 1103 | + | 25 doctoraldegreefromaprogramaccreditedbytheCouncilon |
|---|
| 1104 | + | 26 AcademicAccreditationoftheAmericanSpeech-Language-Hearing |
|---|
| 1105 | + | 27 Associationorotheraccreditingagencyapprovedbytheboardin |
|---|
| 1106 | + | 28 theareainwhichlicensureissought. |
|---|
| 1107 | + | 345.050.[1.] Tobeeligibleforlicensurebytheboardby |
|---|
| 1108 | + | 2 examination,eachapplicantshallsubmittheapplicationfeeand |
|---|
| 1109 | + | 3 shallfurnishevidenceofsuchperson'scurrentcompetenceand |
|---|
| 1110 | + | 41 4 shall: |
|---|
| 1111 | + | 5 (1)Holdamaster'soradoctoraldegreefromaprogramthat |
|---|
| 1112 | + | 6 wasawarded"accreditationcandidate"statusorisaccreditedby |
|---|
| 1113 | + | 7 theCouncilonAcademicAccreditationoftheAmericanSpeech- |
|---|
| 1114 | + | 8 Language-Hearing Associationorotheraccreditingagencyapproved |
|---|
| 1115 | + | 9 bytheboardintheareainwhichlicensureissought; |
|---|
| 1116 | + | 10 (2)Submitofficialtranscriptsfromoneormoreaccredited |
|---|
| 1117 | + | 11 collegesoruniversitiespresentingevidenceofthecompletionof |
|---|
| 1118 | + | 12 courseworkandclinicalpracticumrequirementsequivalenttothat |
|---|
| 1119 | + | 13 requiredbytheCouncilonAcademicAccreditationoftheAmerican |
|---|
| 1120 | + | 14 Speech-Language-Hearing Associationorotheraccreditingagency |
|---|
| 1121 | + | 15 approvedbytheboard;[and] |
|---|
| 1122 | + | 16 (3)Presentwrittenevidenceofcompletionofaclinical |
|---|
| 1123 | + | 17 fellowshipfromsupervisors. Theexperiencerequiredbythis |
|---|
| 1124 | + | 18 subdivisionshallfollowthecompletionoftherequirementsof |
|---|
| 1125 | + | 19 subdivisions(1)and(2)ofthissubsection. Thisperiodof |
|---|
| 1126 | + | 20 employmentshallbeunderthedirectsupervisionofapersonwhois |
|---|
| 1127 | + | 21 licensedbythestateofMissouriintheprofessioninwhichthe |
|---|
| 1128 | + | 22 applicantseekstobelicensed.Personsapplyingwithanaudiology |
|---|
| 1129 | + | 23 clinicaldoctoraldegreeareexemptfromthisprovision;and |
|---|
| 1130 | + | 24 (4)Passanexaminationpromulgatedorapprovedbytheboard. |
|---|
| 1131 | + | 25 Theboardshalldeterminethesubjectandscopeofthe |
|---|
| 1132 | + | 26 examinations. |
|---|
| 1133 | + | 27 [2.Tobeeligibleforlicensurebytheboardwithout |
|---|
| 1134 | + | 28 examination,eachapplicantshallmakeapplicationonforms |
|---|
| 1135 | + | 29 prescribedbytheboard,submittheapplicationfee,submitan |
|---|
| 1136 | + | 30 activitystatementandmeetoneofthefollowingrequirements: |
|---|
| 1137 | + | 42 31 (1)Theboardshallissuealicensetoanyspeech-language |
|---|
| 1138 | + | 32 pathologistoraudiologistwhoislicensedinanothercountryand |
|---|
| 1139 | + | 33 whohashadnoviolations,suspensionorrevocationsofalicense |
|---|
| 1140 | + | 34 topracticespeech-language pathologyoraudiologyinany |
|---|
| 1141 | + | 35 jurisdiction;providedthat,suchpersonislicensedinacountry |
|---|
| 1142 | + | 36 whoserequirementsaresubstantiallyequalto,orgreaterthan, |
|---|
| 1143 | + | 37 Missouriatthetimetheapplicantappliesforlicensure;or |
|---|
| 1144 | + | 38 (2)Holdthecertificateofclinicalcompetenceissuedbythe |
|---|
| 1145 | + | 39 AmericanSpeech-Language-Hearing Associationintheareainwhich |
|---|
| 1146 | + | 40 licensureissought.] |
|---|
| 1147 | + | 345.052.1.Forpurposesofthissection,thefollowing |
|---|
| 1148 | + | 2 termsmean: |
|---|
| 1149 | + | 3 (1)"Board",theMissouriboardofregistrationforthe |
|---|
| 1150 | + | 4 healingarts; |
|---|
| 1151 | + | 5 (2)"Commission",theadvisorycommissionforspeech- |
|---|
| 1152 | + | 6 languagepathologistsandaudiologists; |
|---|
| 1153 | + | 7 (3)"License",alicense,certificate,registration,permit, |
|---|
| 1154 | + | 8 accreditation,ormilitaryoccupationalspecialtythatenablesa |
|---|
| 1155 | + | 9 persontolegallypracticeanoccupationorprofessionina |
|---|
| 1156 | + | 10 particularjurisdiction; |
|---|
| 1157 | + | 11 (4)"Military",theArmedForcesoftheUnitedStates |
|---|
| 1158 | + | 12 includingtheAirForce,Army,CoastGuard,MarineCorps,Navy, |
|---|
| 1159 | + | 13 SpaceForce,NationalGuard,andanyothermilitarybranchthatis |
|---|
| 1160 | + | 14 designatedbyCongressaspartoftheArmedForcesoftheUnited |
|---|
| 1161 | + | 15 States,andallreservecomponentsandauxiliaries. Suchtermalso |
|---|
| 1162 | + | 16 includesthemilitaryreservesandmilitiaoftheUnitedStates |
|---|
| 1163 | + | 17 territoryorstate; |
|---|
| 1164 | + | 43 18 (5)"Nonresidentmilitaryspouse",anonresidentspouseof |
|---|
| 1165 | + | 19 anactivedutymemberoftheArmedForcesoftheUnitedStateswho |
|---|
| 1166 | + | 20 hasbeentransferredorisscheduledtobetransferredtoan |
|---|
| 1167 | + | 21 adjacentstateandisorwillbedomiciledinthestateof |
|---|
| 1168 | + | 22 Missouri,orhasmovedtothestateofMissourionapermanent |
|---|
| 1169 | + | 23 change-of-station basis; |
|---|
| 1170 | + | 24 (6)"Residentmilitaryspouse",aspouseofanactiveduty |
|---|
| 1171 | + | 25 memberoftheArmedForcesoftheUnitedStateswhohasbeen |
|---|
| 1172 | + | 26 transferredorisscheduledtobetransferredtothestateof |
|---|
| 1173 | + | 27 Missouri,whoisdomiciledinthestateofMissouri,orwhohas |
|---|
| 1174 | + | 28 Missouriashisorherhomeofrecord. |
|---|
| 1175 | + | 29 2.Anypersonwhoholdsavalidcurrentspeech-language |
|---|
| 1176 | + | 30 pathologistoraudiologistlicenseissuedbyanotherstate,a |
|---|
| 1177 | + | 31 branchorunitofthemilitary,aterritoryoftheUnitedStates, |
|---|
| 1178 | + | 32 ortheDistrictofColumbia,andwhohasbeenlicensedforatleast |
|---|
| 1179 | + | 33 oneyearintheotherjurisdiction,maysubmitanapplicationfora |
|---|
| 1180 | + | 34 speech-language pathologistoraudiologistlicenseinMissouri |
|---|
| 1181 | + | 35 alongwithproofofcurrentlicensureandproofoflicensureforat |
|---|
| 1182 | + | 36 leastoneyearintheotherjurisdiction,totheboard. |
|---|
| 1183 | + | 37 3.Theboardshall: |
|---|
| 1184 | + | 38 (1)Withinsixmonthsofreceivinganapplicationdescribed |
|---|
| 1185 | + | 39 insubsection2ofthissection,waiveanyexamination, |
|---|
| 1186 | + | 40 educational,orexperiencerequirementsforlicensureinthis |
|---|
| 1187 | + | 41 statefortheapplicantifitdeterminesthattherewereminimum |
|---|
| 1188 | + | 42 educationrequirementsand,ifapplicable,workexperienceand |
|---|
| 1189 | + | 43 clinicalsupervisionrequirementsineffectandtheotherstate |
|---|
| 1190 | + | 44 verifiesthatthepersonmetthoserequirementsinordertobe |
|---|
| 1191 | + | 44 45 licensedorcertifiedinthatstate.Theboardmayrequirean |
|---|
| 1192 | + | 46 applicanttotakeandpassanexaminationspecifictothelawsof |
|---|
| 1193 | + | 47 thisstate;or |
|---|
| 1194 | + | 48 (2)Withinthirtydaysofreceivinganapplicationdescribed |
|---|
| 1195 | + | 49 insubsection2ofthissectionfromanonresidentmilitaryspouse |
|---|
| 1196 | + | 50 oraresidentmilitaryspouse,waiveanyexamination,educational, |
|---|
| 1197 | + | 51 orexperiencerequirementsforlicensureinthisstateforthe |
|---|
| 1198 | + | 52 applicantandissuesuchapplicantalicenseunderthissectionif |
|---|
| 1199 | + | 53 suchapplicantotherwisemeetstherequirementsofthissection. |
|---|
| 1200 | + | 54 4.(1)Theboardshallnotwaiveanyexamination, |
|---|
| 1201 | + | 55 educational,orexperiencerequirementsforanyapplicantwhohas |
|---|
| 1202 | + | 56 hadhisorherlicenserevokedbyaboardoutsidethestate;whois |
|---|
| 1203 | + | 57 currentlyunderinvestigation,whohasacomplaintpending,orwho |
|---|
| 1204 | + | 58 iscurrentlyunderdisciplinaryaction,exceptasprovidedin |
|---|
| 1205 | + | 59 subdivision(2)ofthissubsection,withaboardoutsidethestate; |
|---|
| 1206 | + | 60 whodoesnotholdalicenseingoodstandingwithaboardoutside |
|---|
| 1207 | + | 61 thestate;whohasacriminalrecordthatwoulddisqualifyhimor |
|---|
| 1208 | + | 62 herforlicensureinMissouri;orwhodoesnotholdavalidcurrent |
|---|
| 1209 | + | 63 licenseintheotherjurisdictiononthedatetheboardreceives |
|---|
| 1210 | + | 64 hisorherapplicationunderthissection. |
|---|
| 1211 | + | 65 (2)Ifanotherjurisdictionhastakendisciplinaryaction |
|---|
| 1212 | + | 66 againstanapplicant,theboardshalldetermineifthecausefor |
|---|
| 1213 | + | 67 theactionwascorrectedandthematterresolved. Ifthematter |
|---|
| 1214 | + | 68 hasnotbeenresolvedbythatjurisdiction,theboardmaydenya |
|---|
| 1215 | + | 69 licenseuntilthematterisresolved. |
|---|
| 1216 | + | 70 5.Nothinginthissectionshallprohibittheboardfrom |
|---|
| 1217 | + | 71 denyingalicensetoanapplicantunderthissectionforanyreason |
|---|
| 1218 | + | 45 72 describedinsection345.065. |
|---|
| 1219 | + | 73 6.Anypersonwhoislicensedundertheprovisionsofthis |
|---|
| 1220 | + | 74 sectionshallbesubjecttotheboard'sjurisdictionandallrules |
|---|
| 1221 | + | 75 andregulationspertainingtothepracticeasaspeech-language |
|---|
| 1222 | + | 76 pathologistoraudiologistinthisstate. |
|---|
| 1223 | + | 77 7.Thissectionshallnotbeconstruedtowaiveany |
|---|
| 1224 | + | 78 requirementforanapplicanttopayanyfees. |
|---|
| 901 | | - | 2 ThepurposeofthisCompactistofacilitateinterstatepracticeofaudiologyand |
|---|
| 902 | | - | 3speech-languagepathologywiththegoalofimprovingpublicaccesstoaudiologyand |
|---|
| 903 | | - | 4speech-languagepathologyservices.Thepracticeofaudiologyandspeech-language |
|---|
| 904 | | - | 5pathologyoccursinthestatewherethepatient/client/studentislocatedatthetimeofthe |
|---|
| 905 | | - | 6patient/client/studentencounter.TheCompactpreservestheregulatoryauthorityof |
|---|
| 906 | | - | 7statestoprotectpublichealthandsafetythroughthecurrentsystemofstatelicensure. |
|---|
| 907 | | - | 8 ThisCompactisdesignedtoachievethefollowingobjectives: |
|---|
| 908 | | - | 9 1.Increasepublicaccesstoaudiologyandspeech-languagepathologyservicesby |
|---|
| 909 | | - | 10providingforthemutualrecognitionofothermemberstatelicenses; |
|---|
| 910 | | - | 11 2.Enhancethestates'abilitytoprotectthepublic'shealthandsafety; |
|---|
| 911 | | - | 12 3.Encouragethecooperationofmemberstatesinregulatingmultistate |
|---|
| 912 | | - | 13audiologyandspeech-languagepathologypractice; |
|---|
| 913 | | - | CCS#2SSHB2149 25 14 4.Supportspousesofrelocatingactivedutymilitarypersonnel; |
|---|
| 914 | | - | 15 5.Enhancetheexchangeoflicensure,investigativeanddisciplinaryinformation |
|---|
| 915 | | - | 16betweenmemberstates; |
|---|
| 916 | | - | 17 6.Allowaremotestatetoholdaproviderofserviceswithacompactprivilegein |
|---|
| 917 | | - | 18thatstateaccountabletothatstate'spracticestandards;and |
|---|
| 918 | | - | 19 7.Allowfortheuseoftelehealthtechnologytofacilitateincreasedaccessto |
|---|
| 919 | | - | 20audiologyandspeech-languagepathologyservices. |
|---|
| 920 | | - | 21 SECTION2.DEFINITIONS |
|---|
| 921 | | - | 22 AsusedinthisCompact,andexceptasotherwiseprovided,thefollowing |
|---|
| 922 | | - | 23definitionsshallapply: |
|---|
| 923 | | - | 24 A."Activedutymilitary"meansfull-timedutystatusintheactiveuniformed |
|---|
| 924 | | - | 25serviceoftheUnitedStates,includingmembersoftheNationalGuardandReserveon |
|---|
| 925 | | - | 26activedutyorderspursuantto10U.S.C.Chapter1209and1211. |
|---|
| 926 | | - | 27 B."Adverseaction"meansanyadministrative,civil,equitableorcriminal |
|---|
| 927 | | - | 28actionpermittedbyastate'slawswhichisimposedbyalicensingboardorother |
|---|
| 928 | | - | 29authorityagainstanaudiologistorspeech-languagepathologist,includingactions |
|---|
| 929 | | - | 30againstanindividual'slicenseorprivilegetopracticesuchasrevocation,suspension, |
|---|
| 930 | | - | 31probation,monitoringofthelicensee,orrestrictiononthelicensee'spractice. |
|---|
| 931 | | - | 32 C."Alternativeprogram"meansanon-disciplinarymonitoringprocess |
|---|
| 932 | | - | 33approvedbyanaudiologyorspeech-languagepathologylicensingboardtoaddress |
|---|
| 933 | | - | 34impairedpractitioners. |
|---|
| 934 | | - | 35 D."Audiologist"meansanindividualwhoislicensedbyastatetopractice |
|---|
| 935 | | - | 36audiology. |
|---|
| 936 | | - | 37 E."Audiology"meansthecareandservicesprovidedbyalicensedaudiologist |
|---|
| 937 | | - | 38assetforthinthememberstate'sstatutesandrules. |
|---|
| 938 | | - | 39 F."AudiologyandSpeech-LanguagePathologyCompactCommission"or |
|---|
| 939 | | - | 40"Commission"meansthenationaladministrativebodywhosemembershipconsistsof |
|---|
| 940 | | - | 41allstatesthathaveenactedtheCompact. |
|---|
| 941 | | - | 42 G."Audiologyandspeech-languagepathologylicensingboard,""audiology |
|---|
| 942 | | - | 43licensingboard,""speech-languagepathologylicensingboard,"or"licensingboard" |
|---|
| 943 | | - | 44meanstheagencyofastatethatisresponsibleforthelicensingandregulationof |
|---|
| 944 | | - | 45audiologistsand/orspeech-languagepathologists. |
|---|
| 945 | | - | 46 H."Compactprivilege"meanstheauthorizationgrantedbyaremotestateto |
|---|
| 946 | | - | 47allowalicenseefromanothermemberstatetopracticeasanaudiologistorspeech- |
|---|
| 947 | | - | 48languagepathologistintheremotestateunderitslawsandrules.Thepracticeof |
|---|
| 948 | | - | 49audiologyorspeech-languagepathologyoccursinthememberstatewherethepatient/ |
|---|
| 949 | | - | 50client/studentislocatedatthetimeofthepatient/client/studentencounter. |
|---|
| 950 | | - | CCS#2SSHB2149 26 51 I."Currentsignificantinvestigativeinformation"meansinvestigative |
|---|
| 951 | | - | 52informationthatalicensingboard,afteraninquiryorinvestigationthatincludes |
|---|
| 952 | | - | 53notificationandanopportunityfortheaudiologistorspeech-languagepathologistto |
|---|
| 953 | | - | 54respond,ifrequiredbystatelaw,hasreasontobelieveisnotgroundlessand,ifproved |
|---|
| 954 | | - | 55true,wouldindicatemorethanaminorinfraction. |
|---|
| 955 | | - | 56 J."Datasystem"meansarepositoryofinformationaboutlicensees,including, |
|---|
| 956 | | - | 57butnotlimitedto,continuingeducation,examination,licensure,investigative,compact |
|---|
| 957 | | - | 58privilegeandadverseaction. |
|---|
| 958 | | - | 59 K."Encumberedlicense"meansalicenseinwhichanadverseactionrestricts |
|---|
| 959 | | - | 60thepracticeofaudiologyorspeech-languagepathologybythelicenseeandsaidadverse |
|---|
| 960 | | - | 61actionhasbeenreportedtotheNationalPractitionersDataBank(NPDB). |
|---|
| 961 | | - | 62 L."ExecutiveCommittee"meansagroupofdirectorselectedorappointedto |
|---|
| 962 | | - | 63actonbehalfof,andwithinthepowersgrantedtothemby,theCommission. |
|---|
| 963 | | - | 64 M."Homestate"meansthememberstatethatisthelicensee'sprimarystateof |
|---|
| 964 | | - | 65residence. |
|---|
| 965 | | - | 66 N."Impairedpractitioner"meansindividualswhoseprofessionalpracticeis |
|---|
| 966 | | - | 67adverselyaffectedbysubstanceabuse,addiction,orotherhealth-relatedconditions. |
|---|
| 967 | | - | 68 O."Licensee"meansanindividualwhocurrentlyholdsanauthorizationfrom |
|---|
| 968 | | - | 69thestatelicensingboardtopracticeasanaudiologistorspeech-languagepathologist. |
|---|
| 969 | | - | 70 P."Memberstate"meansastatethathasenactedtheCompact. |
|---|
| 970 | | - | 71 Q."Privilegetopractice"meansalegalauthorizationpermittingthepracticeof |
|---|
| 971 | | - | 72audiologyorspeech-languagepathologyinaremotestate. |
|---|
| 972 | | - | 73 R."Remotestate"meansamemberstateotherthanthehomestatewherea |
|---|
| 973 | | - | 74licenseeisexercisingorseekingtoexercisethecompactprivilege. |
|---|
| 974 | | - | 75 S."Rule"meansaregulation,principleordirectivepromulgatedbythe |
|---|
| 975 | | - | 76Commissionthathastheforceoflaw. |
|---|
| 976 | | - | 77 T."Single-statelicense"meansanaudiologyorspeech-languagepathology |
|---|
| 977 | | - | 78licenseissuedbyamemberstatethatauthorizespracticeonlywithintheissuingstate |
|---|
| 978 | | - | 79anddoesnotincludeaprivilegetopracticeinanyothermemberstate. |
|---|
| 979 | | - | 80 U."Speech-languagepathologist"meansanindividualwhoislicensedbyastate |
|---|
| 980 | | - | 81topracticespeech-languagepathology. |
|---|
| 981 | | - | 82 V."Speech-languagepathology"meansthecareandservicesprovidedbya |
|---|
| 982 | | - | 83licensedspeech-languagepathologistassetforthinthememberstate'sstatutesand |
|---|
| 983 | | - | 84rules. |
|---|
| 984 | | - | 85 W."State"meansanystate,commonwealth,districtorterritoryoftheUnited |
|---|
| 985 | | - | 86StatesofAmericathatregulatesthepracticeofaudiologyandspeech-language |
|---|
| 986 | | - | 87pathology. |
|---|
| 987 | | - | CCS#2SSHB2149 27 88 X."Statepracticelaws"meansamemberstate'slaws,rulesandregulationsthat |
|---|
| 988 | | - | 89governthepracticeofaudiologyorspeech-languagepathology,definethescopeof |
|---|
| 989 | | - | 90audiologyorspeech-languagepathologypractice,andcreatethemethodsandgrounds |
|---|
| 990 | | - | 91forimposingdiscipline. |
|---|
| 991 | | - | 92 Y."Telehealth"meanstheapplicationoftelecommunicationtechnologyto |
|---|
| 992 | | - | 93deliveraudiologyorspeech-languagepathologyservicesatadistanceforassessment, |
|---|
| 993 | | - | 94interventionand/orconsultation. |
|---|
| 994 | | - | 95 SECTION3.STATEPARTICIPATIONINTHECOMPACT |
|---|
| 995 | | - | 96 A.Alicenseissuedtoanaudiologistorspeech-languagepathologistbyahome |
|---|
| 996 | | - | 97statetoaresidentinthatstateshallberecognizedbyeachmemberstateasauthorizing |
|---|
| 997 | | - | 98anaudiologistorspeech-languagepathologisttopracticeaudiologyorspeech-language |
|---|
| 998 | | - | 99pathology,underaprivilegetopractice,ineachmemberstate. |
|---|
| 999 | | - | 100 B.Astatemustimplementorutilizeproceduresforconsideringthecriminal |
|---|
| 1000 | | - | 101historyrecordsofapplicantsforinitialprivilegetopractice.Theseproceduresshall |
|---|
| 1001 | | - | 102includethesubmissionoffingerprintsorotherbiometric-basedinformationby |
|---|
| 1002 | | - | 103applicantsforthepurposeofobtaininganapplicant'scriminalhistoryrecord |
|---|
| 1003 | | - | 104informationfromtheFederalBureauofInvestigationandtheagencyresponsiblefor |
|---|
| 1004 | | - | 105retainingthatstate'scriminalrecords. |
|---|
| 1005 | | - | 106 1.Amemberstatemustfullyimplementacriminalbackgroundcheck |
|---|
| 1006 | | - | 107requirement,withinatimeframeestablishedbyrule,byreceivingtheresultsofthe |
|---|
| 1007 | | - | 108FederalBureauofInvestigationrecordsearchoncriminalbackgroundchecksanduse |
|---|
| 1008 | | - | 109theresultsinmakinglicensuredecisions. |
|---|
| 1009 | | - | 110 2.Communicationbetweenamemberstate,theCommissionandamong |
|---|
| 1010 | | - | 111memberstatesregardingtheverificationofeligibilityforlicensurethroughthe |
|---|
| 1011 | | - | 112CompactshallnotincludeanyinformationreceivedfromtheFederalBureauof |
|---|
| 1012 | | - | 113Investigationrelatingtoafederalcriminalrecordscheckperformedbyamemberstate |
|---|
| 1013 | | - | 114underPublicLaw92-544. |
|---|
| 1014 | | - | 115 C.Uponapplicationforaprivilegetopractice,thelicensingboardintheissuing |
|---|
| 1015 | | - | 116remotestateshallascertain,throughthedatasystem,whethertheapplicanthasever |
|---|
| 1016 | | - | 117held,oristheholderof,alicenseissuedbyanyotherstate,whetherthereareany |
|---|
| 1017 | | - | 118encumbrancesonanylicenseorprivilegetopracticeheldbytheapplicant,whetherany |
|---|
| 1018 | | - | 119adverseactionhasbeentakenagainstanylicenseorprivilegetopracticeheldbythe |
|---|
| 1019 | | - | 120applicant. |
|---|
| 1020 | | - | 121 D.Eachmemberstateshallrequireanapplicanttoobtainorretainalicensein |
|---|
| 1021 | | - | 122thehomestateandmeetthehomestate'squalificationsforlicensureorrenewalof |
|---|
| 1022 | | - | 123licensure,aswellas,allotherapplicablestatelaws. |
|---|
| 1023 | | - | 124 E.Foranaudiologist: |
|---|
| 1024 | | - | CCS#2SSHB2149 28 125 1.Mustmeetoneofthefollowingeducationalrequirements: |
|---|
| 1025 | | - | 126 a.Onorbefore,Dec.31,2007,hasgraduatedwithamaster'sdegreeordoctorate |
|---|
| 1026 | | - | 127inaudiology,orequivalentdegreeregardlessofdegreename,fromaprogramthatis |
|---|
| 1027 | | - | 128accreditedbyanaccreditingagencyrecognizedbytheCouncilforHigherEducation |
|---|
| 1028 | | - | 129Accreditation,oritssuccessor,orbytheUnitedStatesDepartmentofEducationand |
|---|
| 1029 | | - | 130operatedbyacollegeoruniversityaccreditedbyaregionalornationalaccrediting |
|---|
| 1030 | | - | 131organizationrecognizedbytheboard;or |
|---|
| 1031 | | - | 132 b.Onorafter,Jan.1,2008,hasgraduatedwithaDoctoraldegreeinaudiology, |
|---|
| 1032 | | - | 133orequivalentdegree,regardlessofdegreename,fromaprogramthatisaccreditedby |
|---|
| 1033 | | - | 134anaccreditingagencyrecognizedbytheCouncilforHigherEducationAccreditation,or |
|---|
| 1034 | | - | 135itssuccessor,orbytheUnitedStatesDepartmentofEducationandoperatedbyacollege |
|---|
| 1035 | | - | 136oruniversityaccreditedbyaregionalornationalaccreditingorganizationrecognized |
|---|
| 1036 | | - | 137bytheboard;or |
|---|
| 1037 | | - | 138 c.Hasgraduatedfromanaudiologyprogramthatishousedinaninstitutionof |
|---|
| 1038 | | - | 139highereducationoutsideoftheUnitedStates(a)forwhichtheprogramandinstitution |
|---|
| 1039 | | - | 140havebeenapprovedbytheauthorizedaccreditingbodyintheapplicablecountryand |
|---|
| 1040 | | - | 141(b)thedegreeprogramhasbeenverifiedbyanindependentcredentialsreviewagency |
|---|
| 1041 | | - | 142tobecomparabletoastatelicensingboard-approvedprogram. |
|---|
| 1042 | | - | 143 2.Hascompletedasupervisedclinicalpracticumexperiencefromanaccredited |
|---|
| 1043 | | - | 144educationalinstitutionoritscooperatingprogramsasrequiredbytheCommission; |
|---|
| 1044 | | - | 145 3.HassuccessfullypassedanationalexaminationapprovedbytheCommission; |
|---|
| 1045 | | - | 146 4.Holdsanactive,unencumberedlicense; |
|---|
| 1046 | | - | 147 5.Hasnotbeenconvictedorfoundguilty,andhasnotenteredintoanagreed |
|---|
| 1047 | | - | 148disposition,ofafelonyrelatedtothepracticeofaudiology,underapplicablestateor |
|---|
| 1048 | | - | 149federalcriminallaw; |
|---|
| 1049 | | - | 150 6.HasavalidUnitedStatesSocialSecurityorNationalPractitioner |
|---|
| 1050 | | - | 151Identificationnumber. |
|---|
| 1051 | | - | 152 F.Foraspeech-languagepathologist: |
|---|
| 1052 | | - | 153 1.Mustmeetoneofthefollowingeducationalrequirements: |
|---|
| 1053 | | - | 154 a.Hasgraduatedwithamaster'sdegreefromaspeech-languagepathology |
|---|
| 1054 | | - | 155programthatisaccreditedbyanorganizationrecognizedbytheUnitedStates |
|---|
| 1055 | | - | 156DepartmentofEducationandoperatedbyacollegeoruniversityaccreditedbya |
|---|
| 1056 | | - | 157regionalornationalaccreditingorganizationrecognizedbytheboard;or |
|---|
| 1057 | | - | 158 b.Hasgraduatedfromaspeech-languagepathologyprogramthatishousedin |
|---|
| 1058 | | - | 159aninstitutionofhighereducationoutsideoftheUnitedStates(a)forwhichtheprogram |
|---|
| 1059 | | - | 160andinstitutionhavebeenapprovedbytheauthorizedaccreditingbodyintheapplicable |
|---|
| 1060 | | - | CCS#2SSHB2149 29 161countryand(b)thedegreeprogramhasbeenverifiedbyanindependentcredentials |
|---|
| 1061 | | - | 162reviewagencytobecomparabletoastatelicensingboard-approvedprogram. |
|---|
| 1062 | | - | 163 2.Hascompletedasupervisedclinicalpracticumexperiencefroman |
|---|
| 1063 | | - | 164educationalinstitutionoritscooperatingprogramsasrequiredbytheCommission; |
|---|
| 1064 | | - | 165 3.Hascompletedasupervisedpostgraduateprofessionalexperienceasrequired |
|---|
| 1065 | | - | 166bytheCommission; |
|---|
| 1066 | | - | 167 4.HassuccessfullypassedanationalexaminationapprovedbytheCommission; |
|---|
| 1067 | | - | 168 5.Holdsanactive,unencumberedlicense; |
|---|
| 1068 | | - | 169 6.Hasnotbeenconvictedorfoundguilty,andhasnotenteredintoanagreed |
|---|
| 1069 | | - | 170disposition,ofafelonyrelatedtothepracticeofspeech-languagepathology,under |
|---|
| 1070 | | - | 171applicablestateorfederalcriminallaw; |
|---|
| 1071 | | - | 172 7.HasavalidUnitedStatesSocialSecurityorNationalPractitioner |
|---|
| 1072 | | - | 173Identificationnumber. |
|---|
| 1073 | | - | 174 G.Theprivilegetopracticeisderivedfromthehomestatelicense. |
|---|
| 1074 | | - | 175 H.Anaudiologistorspeech-languagepathologistpracticinginamemberstate |
|---|
| 1075 | | - | 176mustcomplywiththestatepracticelawsofthestateinwhichtheclientislocatedatthe |
|---|
| 1076 | | - | 177timeserviceisprovided.Thepracticeofaudiologyandspeech-languagepathologyshall |
|---|
| 1077 | | - | 178includeallaudiologyandspeech-languagepathologypracticeasdefinedbythestate |
|---|
| 1078 | | - | 179practicelawsofthememberstateinwhichtheclientislocated.Thepracticeof |
|---|
| 1079 | | - | 180audiologyandspeech-languagepathologyinamemberstateunderaprivilegeto |
|---|
| 1080 | | - | 181practiceshallsubjectanaudiologistorspeech-languagepathologisttothejurisdictionof |
|---|
| 1081 | | - | 182thelicensingboard,thecourtsandthelawsofthememberstateinwhichtheclientis |
|---|
| 1082 | | - | 183locatedatthetimeserviceisprovided. |
|---|
| 1083 | | - | 184 I.Individualsnotresidinginamemberstateshallcontinuetobeabletoapply |
|---|
| 1084 | | - | 185foramemberstate'ssingle-statelicenseasprovidedunderthelawsofeachmember |
|---|
| 1085 | | - | 186state.However,thesingle-statelicensegrantedtotheseindividualsshallnotbe |
|---|
| 1086 | | - | 187recognizedasgrantingtheprivilegetopracticeaudiologyorspeech-languagepathology |
|---|
| 1087 | | - | 188inanyothermemberstate.NothinginthisCompactshallaffecttherequirements |
|---|
| 1088 | | - | 189establishedbyamemberstatefortheissuanceofasingle-statelicense. |
|---|
| 1089 | | - | 190 J.Memberstatesmaychargeafeeforgrantingacompactprivilege. |
|---|
| 1090 | | - | 191 K.Memberstatesmustcomplywiththebylawsandrulesandregulationsofthe |
|---|
| 1091 | | - | 192Commission. |
|---|
| 1092 | | - | 193 SECTION4.COMPACTPRIVILEGE |
|---|
| 1093 | | - | 194 A.Toexercisethecompactprivilegeunderthetermsandprovisionsofthe |
|---|
| 1094 | | - | 195Compact,theaudiologistorspeech-languagepathologistshall: |
|---|
| 1095 | | - | 196 1.Holdanactivelicenseinthehomestate; |
|---|
| 1096 | | - | 197 2.Havenoencumbranceonanystatelicense; |
|---|
| 1097 | | - | CCS#2SSHB2149 30 198 3.Beeligibleforacompactprivilegeinanymemberstateinaccordancewith |
|---|
| 1098 | | - | 199Section3; |
|---|
| 1099 | | - | 200 4.Havenothadanyadverseactionagainstanylicenseorcompactprivilege |
|---|
| 1100 | | - | 201withintheprevious2yearsfromdateofapplication; |
|---|
| 1101 | | - | 202 5.NotifytheCommissionthatthelicenseeisseekingthecompactprivilege |
|---|
| 1102 | | - | 203withinaremotestate(s); |
|---|
| 1103 | | - | 204 6.Payanyapplicablefees,includinganystatefee,forthecompactprivilege; |
|---|
| 1104 | | - | 205 7.ReporttotheCommissionadverseactiontakenbyanynon-memberstate |
|---|
| 1105 | | - | 206within30daysfromthedatetheadverseactionistaken. |
|---|
| 1106 | | - | 207 B.Forthepurposesofthecompactprivilege,anaudiologistorspeech-language |
|---|
| 1107 | | - | 208pathologistshallonlyholdonehomestatelicenseatatime. |
|---|
| 1108 | | - | 209 C.ExceptasprovidedinSection6,ifanaudiologistorspeech-language |
|---|
| 1109 | | - | 210pathologistchangesprimarystateofresidencebymovingbetweentwo-memberstates, |
|---|
| 1110 | | - | 211theaudiologistorspeech-languagepathologistmustapplyforlicensureinthenewhome |
|---|
| 1111 | | - | 212state,andthelicenseissuedbythepriorhomestateshallbedeactivatedinaccordance |
|---|
| 1112 | | - | 213withapplicablerulesadoptedbytheCommission. |
|---|
| 1113 | | - | 214 D.Theaudiologistorspeech-languagepathologistmayapplyforlicensurein |
|---|
| 1114 | | - | 215advanceofachangeinprimarystateofresidence. |
|---|
| 1115 | | - | 216 E.Alicenseshallnotbeissuedbythenewhomestateuntiltheaudiologistor |
|---|
| 1116 | | - | 217speech-languagepathologistprovidessatisfactoryevidenceofachangeinprimarystate |
|---|
| 1117 | | - | 218ofresidencetothenewhomestateandsatisfiesallapplicablerequirementstoobtaina |
|---|
| 1118 | | - | 219licensefromthenewhomestate. |
|---|
| 1119 | | - | 220 F.Ifanaudiologistorspeech-languagepathologistchangesprimarystateof |
|---|
| 1120 | | - | 221residencebymovingfromamemberstatetoanon-memberstate,thelicenseissuedby |
|---|
| 1121 | | - | 222thepriorhomestateshallconverttoasingle-statelicense,validonlyintheformerhome |
|---|
| 1122 | | - | 223state. |
|---|
| 1123 | | - | 224 G.Thecompactprivilegeisvaliduntiltheexpirationdateofthehomestate |
|---|
| 1124 | | - | 225license.ThelicenseemustcomplywiththerequirementsofSection4Atomaintainthe |
|---|
| 1125 | | - | 226compactprivilegeintheremotestate. |
|---|
| 1126 | | - | 227 H.Alicenseeprovidingaudiologyorspeech-languagepathologyservicesina |
|---|
| 1127 | | - | 228remotestateunderthecompactprivilegeshallfunctionwithinthelawsandregulations |
|---|
| 1128 | | - | 229oftheremotestate. |
|---|
| 1129 | | - | 230 I.Alicenseeprovidingaudiologyorspeech-languagepathologyservicesina |
|---|
| 1130 | | - | 231remotestateissubjecttothatstate'sregulatoryauthority.Aremotestatemay,in |
|---|
| 1131 | | - | 232accordancewithdueprocessandthatstate'slaws,removealicensee'scompactprivilege |
|---|
| 1132 | | - | 233intheremotestateforaspecificperiodoftime,imposefines,and/ortakeanyother |
|---|
| 1133 | | - | 234necessaryactionstoprotectthehealthandsafetyofitscitizens. |
|---|
| 1134 | | - | CCS#2SSHB2149 31 235 J.Ifahomestatelicenseisencumbered,thelicenseeshalllosethecompact |
|---|
| 1135 | | - | 236privilegeinanyremotestateuntilthefollowingoccur: |
|---|
| 1136 | | - | 237 1.Thehomestatelicenseisnolongerencumbered;and |
|---|
| 1137 | | - | 238 2.Twoyearshaveelapsedfromthedateoftheadverseaction. |
|---|
| 1138 | | - | 239 K.Onceanencumberedlicenseinthehomestateisrestoredtogoodstanding, |
|---|
| 1139 | | - | 240thelicenseemustmeettherequirementsofSection4Atoobtainacompactprivilegein |
|---|
| 1140 | | - | 241anyremotestate. |
|---|
| 1141 | | - | 242 L.OncetherequirementsofSection4Jhavebeenmet,thelicenseemustmeet |
|---|
| 1142 | | - | 243therequirementsinSection4Atoobtainacompactprivilegeinaremotestate. |
|---|
| 1143 | | - | 244 SECTION5.COMPACTPRIVILEGETOPRACTICETELEHEALTH |
|---|
| 1144 | | - | 245 Memberstatesshallrecognizetherightofanaudiologistorspeech-language |
|---|
| 1145 | | - | 246pathologist,licensedbyahomestateinaccordancewithSection3andunderrules |
|---|
| 1146 | | - | 247promulgatedbytheCommission,topracticeaudiologyorspeech-languagepathologyin |
|---|
| 1147 | | - | 248anymemberstateviatelehealthunderaprivilegetopracticeasprovidedinthe |
|---|
| 1148 | | - | 249CompactandrulespromulgatedbytheCommission. |
|---|
| 1149 | | - | 250 SECTION6.ACTIVEDUTYMILITARYPERSONNELORTHEIRSPOUSES |
|---|
| 1150 | | - | 251 Activedutymilitarypersonnel,ortheirspouse,shalldesignateahomestate |
|---|
| 1151 | | - | 252wheretheindividualhasacurrentlicenseingoodstanding.Theindividualmayretain |
|---|
| 1152 | | - | 253thehomestatedesignationduringtheperiodtheservicememberisonactiveduty. |
|---|
| 1153 | | - | 254Subsequenttodesignatingahomestate,theindividualshallonlychangetheirhome |
|---|
| 1154 | | - | 255statethroughapplicationforlicensureinthenewstate. |
|---|
| 1155 | | - | 256 SECTION7.ADVERSEACTIONS |
|---|
| 1156 | | - | 257 A.Inadditiontotheotherpowersconferredbystatelaw,aremotestateshall |
|---|
| 1157 | | - | 258havetheauthority,inaccordancewithexistingstatedueprocesslaw,to: |
|---|
| 1158 | | - | 259 1.Takeadverseactionagainstanaudiologist'sorspeech-languagepathologist's |
|---|
| 1159 | | - | 260privilegetopracticewithinthatmemberstate. |
|---|
| 1160 | | - | 261 2.Issuesubpoenasforbothhearingsandinvestigationsthatrequirethe |
|---|
| 1161 | | - | 262attendanceandtestimonyofwitnessesaswellastheproductionofevidence.Subpoenas |
|---|
| 1162 | | - | 263issuedbyalicensingboardinamemberstatefortheattendanceandtestimonyof |
|---|
| 1163 | | - | 264witnessesortheproductionofevidencefromanothermemberstateshallbeenforcedin |
|---|
| 1164 | | - | 265thelatterstatebyanycourtofcompetentjurisdiction,accordingtothepracticeand |
|---|
| 1165 | | - | 266procedureofthatcourtapplicabletosubpoenasissuedinproceedingspendingbeforeit. |
|---|
| 1166 | | - | 267Theissuingauthorityshallpayanywitnessfees,travelexpenses,mileageandotherfees |
|---|
| 1167 | | - | 268requiredbytheservicestatutesofthestateinwhichthewitnessesorevidenceare |
|---|
| 1168 | | - | 269located. |
|---|
| 1169 | | - | 270 3.Onlythehomestateshallhavethepowertotakeadverseactionagainstan |
|---|
| 1170 | | - | 271audiologist'sorspeech-languagepathologist'slicenseissuedbythehomestate. |
|---|
| 1171 | | - | CCS#2SSHB2149 32 272 B.Forpurposesoftakingadverseaction,thehomestateshallgivethesame |
|---|
| 1172 | | - | 273priorityandeffecttoreportedconductreceivedfromamemberstateasitwouldifthe |
|---|
| 1173 | | - | 274conducthadoccurredwithinthehomestate.Insodoing,thehomestateshallapplyits |
|---|
| 1174 | | - | 275ownstatelawstodetermineappropriateaction. |
|---|
| 1175 | | - | 276 C.Thehomestateshallcompleteanypendinginvestigationsofanaudiologistor |
|---|
| 1176 | | - | 277speech-languagepathologistwhochangesprimarystateofresidenceduringthecourse |
|---|
| 1177 | | - | 278oftheinvestigations.Thehomestateshallalsohavetheauthoritytotakeappropriate |
|---|
| 1178 | | - | 279action(s)andshallpromptlyreporttheconclusionsoftheinvestigationstothe |
|---|
| 1179 | | - | 280administratorofthedatasystem.Theadministratorofthecoordinatedlicensure |
|---|
| 1180 | | - | 281informationsystemshallpromptlynotifythenewhomestateofanyadverseactions. |
|---|
| 1181 | | - | 282 D.Ifotherwisepermittedbystatelaw,thememberstatemayrecoverfromthe |
|---|
| 1182 | | - | 283affectedaudiologistorspeech-languagepathologistthecostsofinvestigationsand |
|---|
| 1183 | | - | 284dispositionofcasesresultingfromanyadverseactiontakenagainstthataudiologistor |
|---|
| 1184 | | - | 285speech-languagepathologist. |
|---|
| 1185 | | - | 286 E.Thememberstatemaytakeadverseactionbasedonthefactualfindingsof |
|---|
| 1186 | | - | 287theremotestate,providedthatthememberstatefollowsthememberstate'sown |
|---|
| 1187 | | - | 288proceduresfortakingtheadverseaction. |
|---|
| 1188 | | - | 289 F.JointInvestigations: |
|---|
| 1189 | | - | 290 1.Inadditiontotheauthoritygrantedtoamemberstatebyitsrespective |
|---|
| 1190 | | - | 291audiologyorspeech-languagepathologypracticeactorotherapplicablestatelaw,any |
|---|
| 1191 | | - | 292memberstatemayparticipatewithothermemberstatesinjointinvestigationsof |
|---|
| 1192 | | - | 293licensees. |
|---|
| 1193 | | - | 294 2.Memberstatesshallshareanyinvestigative,litigation,orcompliance |
|---|
| 1194 | | - | 295materialsinfurtheranceofanyjointorindividualinvestigationinitiatedunderthe |
|---|
| 1195 | | - | 296Compact. |
|---|
| 1196 | | - | 297 G.Ifadverseactionistakenbythehomestateagainstanaudiologist'sorspeech- |
|---|
| 1197 | | - | 298languagepathologist'slicense,theaudiologist'sorspeech-languagepathologist's |
|---|
| 1198 | | - | 299privilegetopracticeinallothermemberstatesshallbedeactivateduntilall |
|---|
| 1199 | | - | 300encumbranceshavebeenremovedfromthestatelicense.Allhomestatedisciplinary |
|---|
| 1200 | | - | 301ordersthatimposeadverseactionagainstanaudiologist'sorspeech-language |
|---|
| 1201 | | - | 302pathologist'slicenseshallincludeastatementthattheaudiologist'sorspeech- |
|---|
| 1202 | | - | 303languagepathologist'sprivilegetopracticeisdeactivatedinallmemberstatesduring |
|---|
| 1203 | | - | 304thependencyoftheorder. |
|---|
| 1204 | | - | 305 H.Ifamemberstatetakesadverseaction,itshallpromptlynotifythe |
|---|
| 1205 | | - | 306administratorofthedatasystem.Theadministratorofthedatasystemshallpromptly |
|---|
| 1206 | | - | 307notifythehomestateofanyadverseactionsbyremotestates. |
|---|
| 1207 | | - | CCS#2SSHB2149 33 308 I.NothinginthisCompactshalloverrideamemberstate'sdecisionthat |
|---|
| 1208 | | - | 309participationinanalternativeprogrammaybeusedinlieuofadverseaction. |
|---|
| 1209 | | - | 310 SECTION8.ESTABLISHMENT OFTHEAUDIOLOGY ANDSPEECH- |
|---|
| 1210 | | - | 311LANGUAGE PATHOLOGY COMPACTCOMMISSION |
|---|
| 1211 | | - | 312 A.TheCompactmemberstatesherebycreateandestablishajointpublicagency |
|---|
| 1212 | | - | 313knownastheAudiologyandSpeech-LanguagePathologyCompactCommission: |
|---|
| 1213 | | - | 314 1.TheCommissionisaninstrumentalityoftheCompactstates. |
|---|
| 1214 | | - | 315 2.VenueisproperandjudicialproceedingsbyoragainsttheCommissionshall |
|---|
| 1215 | | - | 316bebroughtsolelyandexclusivelyinacourtofcompetentjurisdictionwherethe |
|---|
| 1216 | | - | 317principalofficeoftheCommissionislocated.TheCommissionmaywaivevenueand |
|---|
| 1217 | | - | 318jurisdictionaldefensestotheextentitadoptsorconsentstoparticipateinalternative |
|---|
| 1218 | | - | 319disputeresolutionproceedings. |
|---|
| 1219 | | - | 320 3.NothinginthisCompactshallbeconstruedtobeawaiverofsovereign |
|---|
| 1220 | | - | 321immunity. |
|---|
| 1221 | | - | 322 B.Membership,VotingandMeetings: |
|---|
| 1222 | | - | 323 1.Eachmemberstateshallhavetwo(2)delegatesselectedbythatmember |
|---|
| 1223 | | - | 324state'slicensingboard.Thedelegatesshallbecurrentmembersofthelicensingboard. |
|---|
| 1224 | | - | 325Oneshallbeanaudiologistandoneshallbeaspeech-languagepathologist. |
|---|
| 1225 | | - | 326 2.Anadditionalfive(5)delegates,whoareeitherapublicmemberorboard |
|---|
| 1226 | | - | 327administratorfromastatelicensingboard,shallbechosenbytheExecutiveCommittee |
|---|
| 1227 | | - | 328fromapoolofnomineesprovidedbytheCommissionatLarge. |
|---|
| 1228 | | - | 329 3.Anydelegatemayberemovedorsuspendedfromofficeasprovidedbythelaw |
|---|
| 1229 | | - | 330ofthestatefromwhichthedelegateisappointed. |
|---|
| 1230 | | - | 331 4.ThememberstateboardshallfillanyvacancyoccurringontheCommission, |
|---|
| 1231 | | - | 332within90days. |
|---|
| 1232 | | - | 333 5.Eachdelegateshallbeentitledtoone(1)votewithregardtothepromulgation |
|---|
| 1233 | | - | 334ofrulesandcreationofbylawsandshallotherwisehaveanopportunitytoparticipatein |
|---|
| 1234 | | - | 335thebusinessandaffairsoftheCommission. |
|---|
| 1235 | | - | 336 6.Adelegateshallvoteinpersonorbyothermeansasprovidedinthebylaws. |
|---|
| 1236 | | - | 337Thebylawsmayprovidefordelegates'participationinmeetingsbytelephoneorother |
|---|
| 1237 | | - | 338meansofcommunication. |
|---|
| 1238 | | - | 339 7.TheCommissionshallmeetatleastonceduringeachcalendaryear. |
|---|
| 1239 | | - | 340Additionalmeetingsshallbeheldassetforthinthebylaws. |
|---|
| 1240 | | - | 341 C.TheCommissionshallhavethefollowingpowersandduties: |
|---|
| 1241 | | - | 342 1.EstablishthefiscalyearoftheCommission; |
|---|
| 1242 | | - | 343 2.Establishbylaws; |
|---|
| 1243 | | - | 344 3.EstablishaCodeofEthics; |
|---|
| 1244 | | - | CCS#2SSHB2149 34 345 4.Maintainitsfinancialrecordsinaccordancewiththebylaws; |
|---|
| 1245 | | - | 346 5.MeetandtakeactionsasareconsistentwiththeprovisionsofthisCompact |
|---|
| 1246 | | - | 347andthebylaws; |
|---|
| 1247 | | - | 348 6.Promulgateuniformrulestofacilitateandcoordinateimplementationand |
|---|
| 1248 | | - | 349administrationofthisCompact.Therulesshallhavetheforceandeffectoflawand |
|---|
| 1249 | | - | 350shallbebindinginallmemberstates; |
|---|
| 1250 | | - | 351 7.Bringandprosecutelegalproceedingsoractionsinthenameofthe |
|---|
| 1251 | | - | 352Commission,providedthatthestandingofanystateaudiologyorspeech-language |
|---|
| 1252 | | - | 353pathologylicensingboardtosueorbesuedunderapplicablelawshallnotbeaffected; |
|---|
| 1253 | | - | 354 8.Purchaseandmaintaininsuranceandbonds; |
|---|
| 1254 | | - | 355 9.Borrow,accept,orcontractforservicesofpersonnel,including,butnot |
|---|
| 1255 | | - | 356limitedto,employeesofamemberstate; |
|---|
| 1256 | | - | 357 10.Hireemployees,electorappointofficers,fixcompensation,defineduties, |
|---|
| 1257 | | - | 358grantindividualsappropriateauthoritytocarryoutthepurposesoftheCompact,and |
|---|
| 1258 | | - | 359toestablishtheCommission'spersonnelpoliciesandprogramsrelatingtoconflictsof |
|---|
| 1259 | | - | 360interest,qualificationsofpersonnel,andotherrelatedpersonnelmatters; |
|---|
| 1260 | | - | 361 11.Acceptanyandallappropriatedonationsandgrantsofmoney,equipment, |
|---|
| 1261 | | - | 362supplies,materialsandservices,andtoreceive,utilizeanddisposeofthesame;provided |
|---|
| 1262 | | - | 363thatatalltimestheCommissionshallavoidanyappearanceofimproprietyand/or |
|---|
| 1263 | | - | 364conflictofinterest; |
|---|
| 1264 | | - | 365 12.Lease,purchase,acceptappropriategiftsordonationsof,orotherwiseto |
|---|
| 1265 | | - | 366own,hold,improveoruse,anyproperty,real,personalormixed;providedthatatall |
|---|
| 1266 | | - | 367timestheCommissionshallavoidanyappearanceofimpropriety; |
|---|
| 1267 | | - | 368 13.Sell,convey,mortgage,pledge,lease,exchange,abandon,orotherwise |
|---|
| 1268 | | - | 369disposeofanypropertyreal,personal,ormixed; |
|---|
| 1269 | | - | 370 14.Establishabudgetandmakeexpenditures; |
|---|
| 1270 | | - | 371 15.Borrowmoney; |
|---|
| 1271 | | - | 372 16.Appointcommittees,includingstandingcommitteescomposedofmembers, |
|---|
| 1272 | | - | 373andotherinterestedpersonsasmaybedesignatedinthisCompactandthebylaws; |
|---|
| 1273 | | - | 374 17.Provideandreceiveinformationfrom,andcooperatewith,lawenforcement |
|---|
| 1274 | | - | 375agencies; |
|---|
| 1275 | | - | 376 18.EstablishandelectanExecutiveCommittee;and |
|---|
| 1276 | | - | 377 19.Performotherfunctionsasmaybenecessaryorappropriatetoachievethe |
|---|
| 1277 | | - | 378purposesofthisCompactconsistentwiththestateregulationofaudiologyandspeech- |
|---|
| 1278 | | - | 379languagepathologylicensureandpractice. |
|---|
| 1279 | | - | 380 D.TheExecutiveCommittee |
|---|
| 1280 | | - | CCS#2SSHB2149 35 381 TheExecutiveCommitteeshallhavethepowertoactonbehalfofthe |
|---|
| 1281 | | - | 382CommissionaccordingtothetermsofthisCompact: |
|---|
| 1282 | | - | 383 1.TheExecutiveCommitteeshallbecomposedoften(10)members: |
|---|
| 1283 | | - | 384 a.Seven(7)votingmemberswhoareelectedbytheCommissionfromthe |
|---|
| 1284 | | - | 385currentmembershipoftheCommission; |
|---|
| 1285 | | - | 386 b.Two(2)ex-officios,consistingofonenonvotingmemberfromarecognized |
|---|
| 1286 | | - | 387nationalaudiologyprofessionalassociationandonenonvotingmemberfroma |
|---|
| 1287 | | - | 388recognizednationalspeech-languagepathologyassociation;and |
|---|
| 1288 | | - | 389 c.One(1)ex-officio,nonvotingmemberfromtherecognizedmembership |
|---|
| 1289 | | - | 390organizationoftheaudiologyandspeech-languagepathologylicensingboards. |
|---|
| 1290 | | - | 391 E.Theex-officiomembersshallbeselectedbytheirrespectiveorganizations. |
|---|
| 1291 | | - | 392 1.TheCommissionmayremoveanymemberoftheExecutiveCommitteeas |
|---|
| 1292 | | - | 393providedinbylaws. |
|---|
| 1293 | | - | 394 2.TheExecutiveCommitteeshallmeetatleastannually. |
|---|
| 1294 | | - | 395 3.TheExecutiveCommitteeshallhavethefollowingdutiesandresponsibilities: |
|---|
| 1295 | | - | 396 a.RecommendtotheentireCommissionchangestotherulesorbylaws,changes |
|---|
| 1296 | | - | 397tothisCompactlegislation,feespaidbyCompactmemberstatessuchasannualdues, |
|---|
| 1297 | | - | 398andanycommissionCompactfeechargedtolicenseesforthecompactprivilege; |
|---|
| 1298 | | - | 399 b.EnsureCompactadministrationservicesareappropriatelyprovided, |
|---|
| 1299 | | - | 400contractualorotherwise; |
|---|
| 1300 | | - | 401 c.Prepareandrecommendthebudget; |
|---|
| 1301 | | - | 402 d.MaintainfinancialrecordsonbehalfoftheCommission; |
|---|
| 1302 | | - | 403 e.MonitorCompactcomplianceofmemberstatesandprovidecompliance |
|---|
| 1303 | | - | 404reportstotheCommission; |
|---|
| 1304 | | - | 405 f.Establishadditionalcommitteesasnecessary;and |
|---|
| 1305 | | - | 406 g.Otherdutiesasprovidedinrulesorbylaws. |
|---|
| 1306 | | - | 407 4.MeetingsoftheCommission |
|---|
| 1307 | | - | 408 Allmeetingsshallbeopentothepublic,andpublicnoticeofmeetingsshallbe |
|---|
| 1308 | | - | 409giveninthesamemannerasrequiredundertherulemakingprovisionsinSection10. |
|---|
| 1309 | | - | 410 5.TheCommissionortheExecutiveCommitteeorothercommitteesofthe |
|---|
| 1310 | | - | 411Commissionmayconveneinaclosed,non-publicmeetingiftheCommissionor |
|---|
| 1311 | | - | 412ExecutiveCommitteeorothercommitteesoftheCommissionmustdiscuss: |
|---|
| 1312 | | - | 413 a.Non-complianceofamemberstatewithitsobligationsundertheCompact; |
|---|
| 1313 | | - | 414 b.Theemployment,compensation,disciplineorothermatters,practicesor |
|---|
| 1314 | | - | 415proceduresrelatedtospecificemployeesorothermattersrelatedtotheCommission's |
|---|
| 1315 | | - | 416internalpersonnelpracticesandprocedures; |
|---|
| 1316 | | - | 417 c.Current,threatened,orreasonablyanticipatedlitigation; |
|---|
| 1317 | | - | CCS#2SSHB2149 36 418 d.Negotiationofcontractsforthepurchase,lease,orsaleofgoods,services,or |
|---|
| 1318 | | - | 419realestate; |
|---|
| 1319 | | - | 420 e.Accusinganypersonofacrimeorformallycensuringanyperson; |
|---|
| 1320 | | - | 421 f.Disclosureoftradesecretsorcommercialorfinancialinformationthatis |
|---|
| 1321 | | - | 422privilegedorconfidential; |
|---|
| 1322 | | - | 423 g.Disclosureofinformationofapersonalnaturewheredisclosurewould |
|---|
| 1323 | | - | 424constituteaclearlyunwarrantedinvasionofpersonalprivacy; |
|---|
| 1324 | | - | 425 h.Disclosureofinvestigativerecordscompiledforlawenforcementpurposes; |
|---|
| 1325 | | - | 426 i.Disclosureofinformationrelatedtoanyinvestigativereportspreparedbyor |
|---|
| 1326 | | - | 427onbehalfoforforuseoftheCommissionorothercommitteechargedwith |
|---|
| 1327 | | - | 428responsibilityofinvestigationordeterminationofcomplianceissuespursuanttothe |
|---|
| 1328 | | - | 429Compact;or |
|---|
| 1329 | | - | 430 j.Mattersspecificallyexemptedfromdisclosurebyfederalormemberstate |
|---|
| 1330 | | - | 431statute. |
|---|
| 1331 | | - | 432 6.Ifameeting,orportionofameeting,isclosedpursuanttothisprovision,the |
|---|
| 1332 | | - | 433Commission'slegalcounselordesigneeshallcertifythatthemeetingmaybeclosedand |
|---|
| 1333 | | - | 434shallreferenceeachrelevantexemptingprovision. |
|---|
| 1334 | | - | 435 7.TheCommissionshallkeepminutesthatfullyandclearlydescribeallmatters |
|---|
| 1335 | | - | 436discussedinameetingandshallprovideafullandaccuratesummaryofactionstaken, |
|---|
| 1336 | | - | 437andthereasonstherefore,includingadescriptionoftheviewsexpressed.Alldocuments |
|---|
| 1337 | | - | 438consideredinconnectionwithanactionshallbeidentifiedinminutes.Allminutesand |
|---|
| 1338 | | - | 439documentsofaclosedmeetingshallremainunderseal,subjecttoreleasebyamajority |
|---|
| 1339 | | - | 440voteoftheCommissionororderofacourtofcompetentjurisdiction. |
|---|
| 1340 | | - | 441 8.FinancingoftheCommission: |
|---|
| 1341 | | - | 442 a.TheCommissionshallpay,orprovideforthepaymentof,thereasonable |
|---|
| 1342 | | - | 443expensesofitsestablishment,organization,andongoingactivities. |
|---|
| 1343 | | - | 444 b.TheCommissionmayacceptanyandallappropriaterevenuesources, |
|---|
| 1344 | | - | 445donations,andgrantsofmoney,equipment,supplies,materials,andservices. |
|---|
| 1345 | | - | 446 c.TheCommissionmaylevyonandcollectanannualassessmentfromeach |
|---|
| 1346 | | - | 447memberstateorimposefeesonotherpartiestocoverthecostoftheoperationsand |
|---|
| 1347 | | - | 448activitiesoftheCommissionanditsstaff,whichmustbeinatotalamountsufficientto |
|---|
| 1348 | | - | 449coveritsannualbudgetasapprovedeachyearforwhichrevenueisnotprovidedby |
|---|
| 1349 | | - | 450othersources.Theaggregateannualassessmentamountshallbeallocatedbasedupona |
|---|
| 1350 | | - | 451formulatobedeterminedbytheCommission,whichshallpromulgatearulebinding |
|---|
| 1351 | | - | 452uponallmemberstates. |
|---|
| 1352 | | - | CCS#2SSHB2149 37 453 9.TheCommissionshallnotincurobligationsofanykindpriortosecuringthe |
|---|
| 1353 | | - | 454fundsadequatetomeetthesame;norshalltheCommissionpledgethecreditofanyof |
|---|
| 1354 | | - | 455thememberstates,exceptbyandwiththeauthorityofthememberstate. |
|---|
| 1355 | | - | 456 10.TheCommissionshallkeepaccurateaccountsofallreceiptsand |
|---|
| 1356 | | - | 457disbursements.ThereceiptsanddisbursementsoftheCommissionshallbesubject |
|---|
| 1357 | | - | 458totheauditandaccountingproceduresestablishedunderitsbylaws.However,all |
|---|
| 1358 | | - | 459receiptsanddisbursementsoffundshandledbytheCommissionshallbeauditedyearly |
|---|
| 1359 | | - | 460byacertifiedorlicensedpublicaccountant,andthereportoftheauditshallbeincluded |
|---|
| 1360 | | - | 461inandbecomepartoftheannualreportoftheCommission. |
|---|
| 1361 | | - | 462 F.QualifiedImmunity,Defense,andIndemnification: |
|---|
| 1362 | | - | 463 1.Themembers,officers,executivedirector,employeesandrepresentativesof |
|---|
| 1363 | | - | 464theCommissionshallbeimmunefromsuitandliability,eitherpersonallyorintheir |
|---|
| 1364 | | - | 465officialcapacity,foranyclaimfordamagetoorlossofpropertyorpersonalinjuryor |
|---|
| 1365 | | - | 466othercivilliabilitycausedbyorarisingoutofanyactualorallegedact,erroror |
|---|
| 1366 | | - | 467omissionthatoccurred,orthatthepersonagainstwhomtheclaimismadehada |
|---|
| 1367 | | - | 468reasonablebasisforbelievingoccurredwithinthescopeofCommissionemployment, |
|---|
| 1368 | | - | 469dutiesorresponsibilities;providedthatnothinginthisparagraphshallbeconstruedto |
|---|
| 1369 | | - | 470protectanypersonfromsuitand/orliabilityforanydamage,loss,injury,orliability |
|---|
| 1370 | | - | 471causedbytheintentionalorwillfulorwantonmisconductofthatperson. |
|---|
| 1371 | | - | 472 2.TheCommissionshalldefendanymember,officer,executivedirector, |
|---|
| 1372 | | - | 473employeeorrepresentativeoftheCommissioninanycivilactionseekingtoimpose |
|---|
| 1373 | | - | 474liabilityarisingoutofanyactualorallegedact,error,oromissionthatoccurredwithin |
|---|
| 1374 | | - | 475thescopeofCommissionemployment,duties,orresponsibilities,orthattheperson |
|---|
| 1375 | | - | 476againstwhomtheclaimismadehadareasonablebasisforbelievingoccurredwithinthe |
|---|
| 1376 | | - | 477scopeofCommissionemployment,duties,orresponsibilities;providedthatnothing |
|---|
| 1377 | | - | 478hereinshallbeconstruedtoprohibitthatpersonfromretaininghisorherowncounsel; |
|---|
| 1378 | | - | 479andprovidedfurther,thattheactualorallegedact,error,oromissiondidnotresult |
|---|
| 1379 | | - | 480fromthatperson'sintentionalorwillfulorwantonmisconduct. |
|---|
| 1380 | | - | 481 3.TheCommissionshallindemnifyandholdharmlessanymember,officer, |
|---|
| 1381 | | - | 482executivedirector,employee,orrepresentativeoftheCommissionfortheamountofany |
|---|
| 1382 | | - | 483settlementorjudgmentobtainedagainstthatpersonarisingoutofanyactualoralleged |
|---|
| 1383 | | - | 484act,errororomissionthatoccurredwithinthescopeofCommissionemployment, |
|---|
| 1384 | | - | 485duties,orresponsibilities,orthatpersonhadareasonablebasisforbelievingoccurred |
|---|
| 1385 | | - | 486withinthescopeofCommissionemployment,duties,orresponsibilities,providedthat |
|---|
| 1386 | | - | 487theactualorallegedact,error,oromissiondidnotresultfromtheintentionalorwillful |
|---|
| 1387 | | - | 488orwantonmisconductofthatperson. |
|---|
| 1388 | | - | 489 SECTION9.DATASYSTEM |
|---|
| 1389 | | - | CCS#2SSHB2149 38 490 A.TheCommissionshallprovideforthedevelopment,maintenance,and |
|---|
| 1390 | | - | 491utilizationofacoordinateddatabaseandreportingsystemcontaininglicensure,adverse |
|---|
| 1391 | | - | 492action,andinvestigativeinformationonalllicensedindividualsinmemberstates. |
|---|
| 1392 | | - | 493 B.Notwithstandinganyotherprovisionofstatelawtothecontrary,amember |
|---|
| 1393 | | - | 494stateshallsubmitauniformdatasettothedatasystemonallindividualstowhomthis |
|---|
| 1394 | | - | 495CompactisapplicableasrequiredbytherulesoftheCommission,including: |
|---|
| 1395 | | - | 496 1.Identifyinginformation; |
|---|
| 1396 | | - | 497 2.Licensuredata; |
|---|
| 1397 | | - | 498 3.Adverseactionsagainstalicenseorcompactprivilege; |
|---|
| 1398 | | - | 499 4.Non-confidentialinformationrelatedtoalternativeprogramparticipation; |
|---|
| 1399 | | - | 500 5.Anydenialofapplicationforlicensure,andthereason(s)fordenial;and |
|---|
| 1400 | | - | 501 6.OtherinformationthatmayfacilitatetheadministrationofthisCompact,as |
|---|
| 1401 | | - | 502determinedbytherulesoftheCommission. |
|---|
| 1402 | | - | 503 C.Investigativeinformationpertainingtoalicenseeinanymemberstateshall |
|---|
| 1403 | | - | 504onlybeavailabletoothermemberstates. |
|---|
| 1404 | | - | 505 D.TheCommissionshallpromptlynotifyallmemberstatesofanyadverse |
|---|
| 1405 | | - | 506actiontakenagainstalicenseeoranindividualapplyingforalicense.Adverseaction |
|---|
| 1406 | | - | 507informationpertainingtoalicenseeinanymemberstateshallbeavailabletoanyother |
|---|
| 1407 | | - | 508memberstate. |
|---|
| 1408 | | - | 509 E.Memberstatescontributinginformationtothedatasystemmaydesignate |
|---|
| 1409 | | - | 510informationthatmaynotbesharedwiththepublicwithouttheexpresspermissionof |
|---|
| 1410 | | - | 511thecontributingstate. |
|---|
| 1411 | | - | 512 F.Anyinformationsubmittedtothedatasystemthatissubsequentlyrequiredto |
|---|
| 1412 | | - | 513beexpungedbythelawsofthememberstatecontributingtheinformationshallbe |
|---|
| 1413 | | - | 514removedfromthedatasystem. |
|---|
| 1414 | | - | 515 SECTION10.RULEMAKING |
|---|
| 1415 | | - | 516 A.TheCommissionshallexerciseitsrulemakingpowerspursuanttothecriteria |
|---|
| 1416 | | - | 517setforthinthisSectionandtherulesadoptedthereunder.Rulesandamendmentsshall |
|---|
| 1417 | | - | 518becomebindingasofthedatespecifiedineachruleoramendment. |
|---|
| 1418 | | - | 519 B.Ifamajorityofthelegislaturesofthememberstatesrejectsarule,by |
|---|
| 1419 | | - | 520enactmentofastatuteorresolutioninthesamemannerusedtoadopttheCompact |
|---|
| 1420 | | - | 521within4yearsofthedateofadoptionoftherule,theruleshallhavenofurtherforceand |
|---|
| 1421 | | - | 522effectinanymemberstate. |
|---|
| 1422 | | - | 523 C.Rulesoramendmentstotherulesshallbeadoptedataregularorspecial |
|---|
| 1423 | | - | 524meetingoftheCommission. |
|---|
| 1424 | | - | 525 D.Priortopromulgationandadoptionofafinalruleorrulesbythe |
|---|
| 1425 | | - | 526Commission,andatleastthirty(30)daysinadvanceofthemeetingatwhichtherule |
|---|
| 1426 | | - | CCS#2SSHB2149 39 527shallbeconsideredandvotedupon,theCommissionshallfileaNoticeofProposed |
|---|
| 1427 | | - | 528Rulemaking: |
|---|
| 1428 | | - | 529 1.OnthewebsiteoftheCommissionorotherpubliclyaccessibleplatform;and |
|---|
| 1429 | | - | 530 2.Onthewebsiteofeachmemberstateaudiologyorspeech-languagepathology |
|---|
| 1430 | | - | 531licensingboardorotherpubliclyaccessibleplatformorthepublicationinwhicheach |
|---|
| 1431 | | - | 532statewouldotherwisepublishproposedrules. |
|---|
| 1432 | | - | 533 E.TheNoticeofProposedRulemakingshallinclude: |
|---|
| 1433 | | - | 534 1.Theproposedtime,date,andlocationofthemeetinginwhichtheruleshallbe |
|---|
| 1434 | | - | 535consideredandvotedupon; |
|---|
| 1435 | | - | 536 2.Thetextoftheproposedruleoramendmentandthereasonfortheproposed |
|---|
| 1436 | | - | 537rule; |
|---|
| 1437 | | - | 538 3.Arequestforcommentsontheproposedrulefromanyinterestedperson;and |
|---|
| 1438 | | - | 539 4.ThemannerinwhichinterestedpersonsmaysubmitnoticetotheCommission |
|---|
| 1439 | | - | 540oftheirintentiontoattendthepublichearingandanywrittencomments. |
|---|
| 1440 | | - | 541 F.Priortotheadoptionofaproposedrule,theCommissionshallallowpersons |
|---|
| 1441 | | - | 542tosubmitwrittendata,facts,opinionsandarguments,whichshallbemadeavailableto |
|---|
| 1442 | | - | 543thepublic. |
|---|
| 1443 | | - | 544 G.TheCommissionshallgrantanopportunityforapublichearingbeforeit |
|---|
| 1444 | | - | 545adoptsaruleoramendmentifahearingisrequestedby: |
|---|
| 1445 | | - | 546 1.Atleasttwenty-five(25)persons; |
|---|
| 1446 | | - | 547 2.Astateorfederalgovernmentalsubdivisionoragency;or |
|---|
| 1447 | | - | 548 3.Anassociationhavingatleasttwenty-five(25)members. |
|---|
| 1448 | | - | 549 H.Ifahearingisheldontheproposedruleoramendment,theCommissionshall |
|---|
| 1449 | | - | 550publishtheplace,time,anddateofthescheduledpublichearing.Ifthehearingisheld |
|---|
| 1450 | | - | 551viaelectronicmeans,theCommissionshallpublishthemechanismforaccesstothe |
|---|
| 1451 | | - | 552electronichearing. |
|---|
| 1452 | | - | 553 1.Allpersonswishingtobeheardatthehearingshallnotifytheexecutive |
|---|
| 1453 | | - | 554directoroftheCommissionorotherdesignatedmemberinwritingoftheirdesireto |
|---|
| 1454 | | - | 555appearandtestifyatthehearingnotlessthanfive(5)businessdaysbeforethescheduled |
|---|
| 1455 | | - | 556dateofthehearing. |
|---|
| 1456 | | - | 557 2.Hearingsshallbeconductedinamannerprovidingeachpersonwhowishesto |
|---|
| 1457 | | - | 558commentafairandreasonableopportunitytocommentorallyorinwriting. |
|---|
| 1458 | | - | 559 3.Allhearingsshallberecorded.Acopyoftherecordingshallbemade |
|---|
| 1459 | | - | 560availableonrequest. |
|---|
| 1460 | | - | 561 4.Nothinginthissectionshallbeconstruedasrequiringaseparatehearingon |
|---|
| 1461 | | - | 562eachrule.RulesmaybegroupedfortheconvenienceoftheCommissionathearings |
|---|
| 1462 | | - | 563requiredbythissection. |
|---|
| 1463 | | - | CCS#2SSHB2149 40 564 I.Followingthescheduledhearingdate,orbythecloseofbusinessonthe |
|---|
| 1464 | | - | 565scheduledhearingdateifthehearingwasnotheld,theCommissionshallconsiderall |
|---|
| 1465 | | - | 566writtenandoralcommentsreceived. |
|---|
| 1466 | | - | 567 J.Ifnowrittennoticeofintenttoattendthepublichearingbyinterestedparties |
|---|
| 1467 | | - | 568isreceived,theCommissionmayproceedwithpromulgationoftheproposedrule |
|---|
| 1468 | | - | 569withoutapublichearing. |
|---|
| 1469 | | - | 570 K.TheCommissionshall,bymajorityvoteofallmembers,takefinalactionon |
|---|
| 1470 | | - | 571theproposedruleandshalldeterminetheeffectivedateoftherule,ifany,basedonthe |
|---|
| 1471 | | - | 572rulemakingrecordandthefulltextoftherule. |
|---|
| 1472 | | - | 573 L.Upondeterminationthatanemergencyexists,theCommissionmayconsider |
|---|
| 1473 | | - | 574andadoptanemergencyrulewithoutpriornotice,opportunityforcomment,or |
|---|
| 1474 | | - | 575hearing,providedthattheusualrulemakingproceduresprovidedintheCompactand |
|---|
| 1475 | | - | 576inthissectionshallberetroactivelyappliedtotheruleassoonasreasonablypossible,in |
|---|
| 1476 | | - | 577noeventlaterthanninety(90)daysaftertheeffectivedateoftherule.Forthepurposes |
|---|
| 1477 | | - | 578ofthisprovision,anemergencyruleisonethatmustbeadoptedimmediatelyinorder |
|---|
| 1478 | | - | 579to: |
|---|
| 1479 | | - | 580 1.Meetanimminentthreattopublichealth,safety,orwelfare; |
|---|
| 1480 | | - | 581 2.PreventalossofCommissionormemberstatefunds;or |
|---|
| 1481 | | - | 582 3.Meetadeadlineforthepromulgationofanadministrativerulethatis |
|---|
| 1482 | | - | 583establishedbyfederallaworrule. |
|---|
| 1483 | | - | 584 M.TheCommissionoranauthorizedcommitteeoftheCommissionmaydirect |
|---|
| 1484 | | - | 585revisionstoapreviouslyadoptedruleoramendmentforpurposesofcorrecting |
|---|
| 1485 | | - | 586typographicalerrors,errorsinformat,errorsinconsistency,orgrammaticalerrors. |
|---|
| 1486 | | - | 587PublicnoticeofanyrevisionsshallbepostedonthewebsiteoftheCommission.The |
|---|
| 1487 | | - | 588revisionshallbesubjecttochallengebyanypersonforaperiodofthirty(30)daysafter |
|---|
| 1488 | | - | 589posting.Therevisionmaybechallengedonlyongroundsthattherevisionresultsina |
|---|
| 1489 | | - | 590materialchangetoarule.Achallengeshallbemadeinwritinganddeliveredtothe |
|---|
| 1490 | | - | 591chairoftheCommissionpriortotheendofthenoticeperiod.Ifnochallengeismade, |
|---|
| 1491 | | - | 592therevisionshalltakeeffectwithoutfurtheraction.Iftherevisionischallenged,the |
|---|
| 1492 | | - | 593revisionmaynottakeeffectwithouttheapprovaloftheCommission. |
|---|
| 1493 | | - | 594 SECTION 11.OVERSIGHT ,DISPUTE RESOLUTION, AND |
|---|
| 1494 | | - | 595ENFORCEMENT |
|---|
| 1495 | | - | 596 A.DisputeResolution |
|---|
| 1496 | | - | 597 1.Uponrequestbyamemberstate,theCommissionshallattempttoresolve |
|---|
| 1497 | | - | 598disputesrelatedtotheCompactthatariseamongmemberstatesandbetweenmember |
|---|
| 1498 | | - | 599andnon-memberstates. |
|---|
| 1499 | | - | CCS#2SSHB2149 41 600 2.TheCommissionshallpromulgatearuleprovidingforbothmediationand |
|---|
| 1500 | | - | 601bindingdisputeresolutionfordisputesasappropriate. |
|---|
| 1501 | | - | 602 B.Enforcement |
|---|
| 1502 | | - | 603 1.TheCommission,inthereasonableexerciseofitsdiscretion,shallenforcethe |
|---|
| 1503 | | - | 604provisionsandrulesofthisCompact. |
|---|
| 1504 | | - | 605 2.Bymajorityvote,theCommissionmayinitiatelegalactionintheUnited |
|---|
| 1505 | | - | 606StatesDistrictCourtfortheDistrictofColumbiaorthefederaldistrictwherethe |
|---|
| 1506 | | - | 607Commissionhasitsprincipalofficesagainstamemberstateindefaulttoenforce |
|---|
| 1507 | | - | 608compliancewiththeprovisionsoftheCompactanditspromulgatedrulesandbylaws. |
|---|
| 1508 | | - | 609Thereliefsoughtmayincludebothinjunctivereliefanddamages.Intheeventjudicial |
|---|
| 1509 | | - | 610enforcementisnecessary,theprevailingmembershallbeawardedallcostsoflitigation, |
|---|
| 1510 | | - | 611includingreasonableattorney'sfees. |
|---|
| 1511 | | - | 612 3.TheremedieshereinshallnotbetheexclusiveremediesoftheCommission. |
|---|
| 1512 | | - | 613TheCommissionmaypursueanyotherremediesavailableunderfederalorstatelaw. |
|---|
| 1513 | | - | 614 SECTION12.DATEOFIMPLEMENTATIONOFTHEINTERSTATE |
|---|
| 1514 | | - | 615COMMISSION FORAUDIOLOGY ANDSPEECH-LANGUAGE PATHOLOGY |
|---|
| 1515 | | - | 616PRACTICEANDASSOCIATEDRULES,WITHDRAWAL,ANDAMENDMENT |
|---|
| 1516 | | - | 617 A.TheCompactshallcomeintoeffectonthedateonwhichtheCompactstatute |
|---|
| 1517 | | - | 618isenactedintolawinthe10thmemberstate.Theprovisions,whichbecomeeffectiveat |
|---|
| 1518 | | - | 619thattime,shallbelimitedtothepowersgrantedtotheCommissionrelatingtoassembly |
|---|
| 1519 | | - | 620andthepromulgationofrules.Thereafter,theCommissionshallmeetandexercise |
|---|
| 1520 | | - | 621rulemakingpowersnecessarytotheimplementationandadministrationofthe |
|---|
| 1521 | | - | 622Compact. |
|---|
| 1522 | | - | 623 B.AnystatethatjoinstheCompactsubsequenttotheCommission'sinitial |
|---|
| 1523 | | - | 624adoptionoftherulesshallbesubjecttotherulesastheyexistonthedateonwhichthe |
|---|
| 1524 | | - | 625Compactbecomeslawinthatstate.Anyrulethathasbeenpreviouslyadoptedbythe |
|---|
| 1525 | | - | 626CommissionshallhavethefullforceandeffectoflawonthedaytheCompactbecomes |
|---|
| 1526 | | - | 627lawinthatstate. |
|---|
| 1527 | | - | 628 C.AnymemberstatemaywithdrawfromthisCompactbyenactingastatute |
|---|
| 1528 | | - | 629repealingthesame. |
|---|
| 1529 | | - | 630 1.Amemberstate'swithdrawalshallnottakeeffectuntilsix(6)monthsafter |
|---|
| 1530 | | - | 631enactmentoftherepealingstatute. |
|---|
| 1531 | | - | 632 2.Withdrawalshallnotaffectthecontinuingrequirementofthewithdrawing |
|---|
| 1532 | | - | 633state'saudiologyorspeech-languagepathologylicensingboardtocomplywiththe |
|---|
| 1533 | | - | 634investigativeandadverseactionreportingrequirementsofthisactpriortotheeffective |
|---|
| 1534 | | - | 635dateofwithdrawal. |
|---|
| 1535 | | - | CCS#2SSHB2149 42 636 D.NothingcontainedinthisCompactshallbeconstruedtoinvalidateorprevent |
|---|
| 1536 | | - | 637anyaudiologyorspeech-languagepathologylicensureagreementorothercooperative |
|---|
| 1537 | | - | 638arrangementbetweenamemberstateandanon-memberstatethatdoesnotconflict |
|---|
| 1538 | | - | 639withtheprovisionsofthisCompact. |
|---|
| 1539 | | - | 640 E.ThisCompactmaybeamendedbythememberstates.Noamendmenttothis |
|---|
| 1540 | | - | 641Compactshallbecomeeffectiveandbindinguponanymemberstateuntilitisenacted |
|---|
| 1541 | | - | 642intothelawsofallmemberstates. |
|---|
| 1542 | | - | 643 SECTION13.CONSTRUCTION ANDSEVERABILITY |
|---|
| 1543 | | - | 644 ThisCompactshallbeliberallyconstruedsoastoeffectuatethepurposes |
|---|
| 1544 | | - | 645thereof.TheprovisionsofthisCompactshallbeseverableandifanyphrase,clause, |
|---|
| 1545 | | - | 646sentenceorprovisionofthisCompactisdeclaredtobecontrarytotheconstitutionof |
|---|
| 1546 | | - | 647anymemberstateoroftheUnitedStatesortheapplicabilitythereoftoanygovernment, |
|---|
| 1547 | | - | 648agency,personorcircumstanceisheldinvalid,thevalidityoftheremainderofthis |
|---|
| 1548 | | - | 649Compactandtheapplicabilitythereoftoanygovernment,agency,personor |
|---|
| 1549 | | - | 650circumstanceshallnotbeaffectedthereby.IfthisCompactshallbeheldcontraryto |
|---|
| 1550 | | - | 651theconstitutionofanymemberstate,theCompactshallremaininfullforceandeffect |
|---|
| 1551 | | - | 652astotheremainingmemberstatesandinfullforceandeffectastothememberstate |
|---|
| 1552 | | - | 653affectedastoallseverablematters. |
|---|
| 1553 | | - | 654 SECTION14.BINDINGEFFECTOFCOMPACTANDOTHERLAWS |
|---|
| 1554 | | - | 655 A.Nothinghereinpreventstheenforcementofanyotherlawofamemberstate |
|---|
| 1555 | | - | 656thatisnotinconsistentwiththeCompact. |
|---|
| 1556 | | - | 657 B.AlllawsinamemberstateinconflictwiththeCompactaresupersededtothe |
|---|
| 1557 | | - | 658extentoftheconflict. |
|---|
| 1558 | | - | 659 C.AlllawfulactionsoftheCommission,includingallrulesandbylaws |
|---|
| 1559 | | - | 660promulgatedbytheCommission,arebindinguponthememberstates. |
|---|
| 1560 | | - | 661 D.AllagreementsbetweentheCommissionandthememberstatesarebinding |
|---|
| 1561 | | - | 662inaccordancewiththeirterms. |
|---|
| 1562 | | - | 663 E.IntheeventanyprovisionoftheCompactexceedstheconstitutionallimits |
|---|
| 1563 | | - | 664imposedonthelegislatureofanymemberstate,theprovisionshallbeineffectivetothe |
|---|
| 1564 | | - | 665extentoftheconflictwiththeconstitutionalprovisioninquestioninthatmemberstate. |
|---|
| 1565 | | - | SectionB.Becauseoftheurgentneedoflow-incomeMissouriresidentsforaccessto |
|---|
| 1566 | | - | 2qualityhealthcareservices,theenactmentofsection324.005ofthisactisdeemednecessary |
|---|
| 1567 | | - | 3fortheimmediatepreservationofthepublichealth,welfare,peace,andsafety,andishereby |
|---|
| 1568 | | - | 4declaredtobeanemergencyactwithinthemeaningoftheconstitution,andtheenactmentof |
|---|
| 1569 | | - | 5section324.005ofthisactshallbeinfullforceandeffectuponitspassageandapproval. |
|---|
| 1570 | | - | ✔ |
|---|
| 1571 | | - | CCS#2SSHB2149 43 |
|---|
| 1226 | + | 2 ThepurposeofthisCompactistofacilitateinterstate |
|---|
| 1227 | + | 3 practiceofaudiologyandspeech-language pathologywiththegoal |
|---|
| 1228 | + | 4 ofimprovingpublicaccesstoaudiologyandspeech-language |
|---|
| 1229 | + | 5 pathologyservices.Thepracticeofaudiologyandspeech-language |
|---|
| 1230 | + | 6 pathologyoccursinthestatewherethepatient/client/student is |
|---|
| 1231 | + | 7 locatedatthetimeofthepatient/client/student encounter. The |
|---|
| 1232 | + | 8 Compactpreservestheregulatoryauthorityofstatestoprotect |
|---|
| 1233 | + | 9 publichealthandsafetythroughthecurrentsystemofstate |
|---|
| 1234 | + | 10 licensure. |
|---|
| 1235 | + | 11 ThisCompactisdesignedtoachievethefollowingobjectives: |
|---|
| 1236 | + | 12 1.Increasepublicaccesstoaudiologyandspeech-language |
|---|
| 1237 | + | 13 pathologyservicesbyprovidingforthemutualrecognitionof |
|---|
| 1238 | + | 14 othermemberstatelicenses; |
|---|
| 1239 | + | 15 2.Enhancethestates'abilitytoprotectthepublic'shealth |
|---|
| 1240 | + | 16 andsafety; |
|---|
| 1241 | + | 17 3.Encouragethecooperationofmemberstatesinregulating |
|---|
| 1242 | + | 18 multistateaudiologyandspeech-language pathologypractice; |
|---|
| 1243 | + | 19 4.Supportspousesofrelocatingactivedutymilitary |
|---|
| 1244 | + | 20 personnel; |
|---|
| 1245 | + | 46 21 5.Enhancetheexchangeoflicensure,investigativeand |
|---|
| 1246 | + | 22 disciplinaryinformationbetweenmemberstates; |
|---|
| 1247 | + | 23 6.Allowaremotestatetoholdaproviderofserviceswitha |
|---|
| 1248 | + | 24 compactprivilegeinthatstateaccountabletothatstate's |
|---|
| 1249 | + | 25 practicestandards;and |
|---|
| 1250 | + | 26 7.Allowfortheuseoftelehealthtechnologytofacilitate |
|---|
| 1251 | + | 27 increasedaccesstoaudiologyandspeech-language pathology |
|---|
| 1252 | + | 28 services. |
|---|
| 1253 | + | 29 SECTION2.DEFINITIONS |
|---|
| 1254 | + | 30 AsusedinthisCompact,andexceptasotherwiseprovided,the |
|---|
| 1255 | + | 31 followingdefinitionsshallapply: |
|---|
| 1256 | + | 32 A."Activedutymilitary"meansfull-timedutystatusinthe |
|---|
| 1257 | + | 33 activeuniformedserviceoftheUnitedStates,includingmembers |
|---|
| 1258 | + | 34 oftheNationalGuardandReserveonactivedutyorderspursuantto |
|---|
| 1259 | + | 35 10U.S.C.Chapter1209and1211. |
|---|
| 1260 | + | 36 B."Adverseaction"meansanyadministrative, civil, |
|---|
| 1261 | + | 37 equitableorcriminalactionpermittedbyastate'slawswhichis |
|---|
| 1262 | + | 38 imposedbyalicensingboardorotherauthorityagainstan |
|---|
| 1263 | + | 39 audiologistorspeech-language pathologist,includingactions |
|---|
| 1264 | + | 40 againstanindividual'slicenseorprivilegetopracticesuchas |
|---|
| 1265 | + | 41 revocation,suspension,probation,monitoringofthelicensee,or |
|---|
| 1266 | + | 42 restrictiononthelicensee'spractice. |
|---|
| 1267 | + | 43 C."Alternativeprogram"meansanon-disciplinary monitoring |
|---|
| 1268 | + | 44 processapprovedbyanaudiologyorspeech-language pathology |
|---|
| 1269 | + | 45 licensingboardtoaddressimpairedpractitioners. |
|---|
| 1270 | + | 46 D."Audiologist"meansanindividualwhoislicensedbya |
|---|
| 1271 | + | 47 statetopracticeaudiology. |
|---|
| 1272 | + | 47 48 E."Audiology"meansthecareandservicesprovidedbya |
|---|
| 1273 | + | 49 licensedaudiologistassetforthinthememberstate'sstatutes |
|---|
| 1274 | + | 50 andrules. |
|---|
| 1275 | + | 51 F."AudiologyandSpeech-Language PathologyCompact |
|---|
| 1276 | + | 52 Commission"or"Commission"meansthenationaladministrativebody |
|---|
| 1277 | + | 53 whosemembershipconsistsofallstatesthathaveenactedthe |
|---|
| 1278 | + | 54 Compact. |
|---|
| 1279 | + | 55 G."Audiologyandspeech-language pathologylicensing |
|---|
| 1280 | + | 56 board,""audiologylicensingboard,""speech-language pathology |
|---|
| 1281 | + | 57 licensingboard,"or"licensingboard"meanstheagencyofastate |
|---|
| 1282 | + | 58 thatisresponsibleforthelicensingandregulationof |
|---|
| 1283 | + | 59 audiologistsand/orspeech-language pathologists. |
|---|
| 1284 | + | 60 H."Compactprivilege"meanstheauthorizationgrantedbya |
|---|
| 1285 | + | 61 remotestatetoallowalicenseefromanothermemberstateto |
|---|
| 1286 | + | 62 practiceasanaudiologistorspeech-language pathologistinthe |
|---|
| 1287 | + | 63 remotestateunderitslawsandrules.Thepracticeofaudiology |
|---|
| 1288 | + | 64 orspeech-language pathologyoccursinthememberstatewherethe |
|---|
| 1289 | + | 65 patient/client/student islocatedatthetimeofthepatient/ |
|---|
| 1290 | + | 66 client/studentencounter. |
|---|
| 1291 | + | 67 I."Currentsignificantinvestigativeinformation"means |
|---|
| 1292 | + | 68 investigativeinformationthatalicensingboard,afteraninquiry |
|---|
| 1293 | + | 69 orinvestigationthatincludesnotificationandanopportunityfor |
|---|
| 1294 | + | 70 theaudiologistorspeech-language pathologisttorespond,if |
|---|
| 1295 | + | 71 requiredbystatelaw,hasreasontobelieveisnotgroundlessand, |
|---|
| 1296 | + | 72 ifprovedtrue,wouldindicatemorethanaminorinfraction. |
|---|
| 1297 | + | 73 J."Datasystem"meansarepositoryofinformationabout |
|---|
| 1298 | + | 74 licensees,including,butnotlimitedto,continuingeducation, |
|---|
| 1299 | + | 48 75 examination,licensure,investigative,compactprivilegeand |
|---|
| 1300 | + | 76 adverseaction. |
|---|
| 1301 | + | 77 K."Encumberedlicense"meansalicenseinwhichanadverse |
|---|
| 1302 | + | 78 actionrestrictsthepracticeofaudiologyorspeech-language |
|---|
| 1303 | + | 79 pathologybythelicenseeandsaidadverseactionhasbeenreported |
|---|
| 1304 | + | 80 totheNationalPractitionersDataBank(NPDB). |
|---|
| 1305 | + | 81 L."ExecutiveCommittee"meansagroupofdirectorselected |
|---|
| 1306 | + | 82 orappointedtoactonbehalfof,andwithinthepowersgrantedto |
|---|
| 1307 | + | 83 themby,theCommission. |
|---|
| 1308 | + | 84 M."Homestate"meansthememberstatethatisthelicensee's |
|---|
| 1309 | + | 85 primarystateofresidence. |
|---|
| 1310 | + | 86 N."Impairedpractitioner"meansindividualswhose |
|---|
| 1311 | + | 87 professionalpracticeisadverselyaffectedbysubstanceabuse, |
|---|
| 1312 | + | 88 addiction,orotherhealth-relatedconditions. |
|---|
| 1313 | + | 89 O."Licensee"meansanindividualwhocurrentlyholdsan |
|---|
| 1314 | + | 90 authorizationfromthestatelicensingboardtopracticeasan |
|---|
| 1315 | + | 91 audiologistorspeech-language pathologist. |
|---|
| 1316 | + | 92 P."Memberstate"meansastatethathasenactedtheCompact. |
|---|
| 1317 | + | 93 Q."Privilegetopractice"meansalegalauthorization |
|---|
| 1318 | + | 94 permittingthepracticeofaudiologyorspeech-language pathology |
|---|
| 1319 | + | 95 inaremotestate. |
|---|
| 1320 | + | 96 R."Remotestate"meansamemberstateotherthanthehome |
|---|
| 1321 | + | 97 statewherealicenseeisexercisingorseekingtoexercisethe |
|---|
| 1322 | + | 98 compactprivilege. |
|---|
| 1323 | + | 99 S."Rule"meansaregulation,principleordirective |
|---|
| 1324 | + | 100 promulgatedbytheCommissionthathastheforceoflaw. |
|---|
| 1325 | + | 101 T."Single-statelicense"meansanaudiologyorspeech- |
|---|
| 1326 | + | 49 102 languagepathologylicenseissuedbyamemberstatethat |
|---|
| 1327 | + | 103 authorizespracticeonlywithintheissuingstateanddoesnot |
|---|
| 1328 | + | 104 includeaprivilegetopracticeinanyothermemberstate. |
|---|
| 1329 | + | 105 U."Speech-language pathologist"meansanindividualwhois |
|---|
| 1330 | + | 106 licensedbyastatetopracticespeech-language pathology. |
|---|
| 1331 | + | 107 V."Speech-language pathology"meansthecareandservices |
|---|
| 1332 | + | 108 providedbyalicensedspeech-language pathologistassetforthin |
|---|
| 1333 | + | 109 thememberstate'sstatutesandrules. |
|---|
| 1334 | + | 110 W."State"meansanystate,commonwealth,districtor |
|---|
| 1335 | + | 111 territoryoftheUnitedStatesofAmericathatregulatesthe |
|---|
| 1336 | + | 112 practiceofaudiologyandspeech-language pathology. |
|---|
| 1337 | + | 113 X."Statepracticelaws"meansamemberstate'slaws,rules |
|---|
| 1338 | + | 114 andregulationsthatgovernthepracticeofaudiologyorspeech- |
|---|
| 1339 | + | 115 languagepathology,definethescopeofaudiologyorspeech- |
|---|
| 1340 | + | 116 languagepathologypractice,andcreatethemethodsandgrounds |
|---|
| 1341 | + | 117 forimposingdiscipline. |
|---|
| 1342 | + | 118 Y."Telehealth"meanstheapplicationoftelecommunication |
|---|
| 1343 | + | 119 technologytodeliveraudiologyorspeech-language pathology |
|---|
| 1344 | + | 120 servicesatadistanceforassessment,interventionand/or |
|---|
| 1345 | + | 121 consultation. |
|---|
| 1346 | + | 122 SECTION3.STATEPARTICIPATIONINTHECOMPACT |
|---|
| 1347 | + | 123 A.Alicenseissuedtoanaudiologistorspeech-language |
|---|
| 1348 | + | 124 pathologistbyahomestatetoaresidentinthatstateshallbe |
|---|
| 1349 | + | 125 recognizedbyeachmemberstateasauthorizinganaudiologistor |
|---|
| 1350 | + | 126 speech-language pathologisttopracticeaudiologyorspeech- |
|---|
| 1351 | + | 127 languagepathology,underaprivilegetopractice,ineachmember |
|---|
| 1352 | + | 128 state. |
|---|
| 1353 | + | 50 129 B.Astatemustimplementorutilizeproceduresfor |
|---|
| 1354 | + | 130 consideringthecriminalhistoryrecordsofapplicantsforinitial |
|---|
| 1355 | + | 131 privilegetopractice. Theseproceduresshallincludethe |
|---|
| 1356 | + | 132 submissionoffingerprintsorotherbiometric-based informationby |
|---|
| 1357 | + | 133 applicantsforthepurposeofobtaininganapplicant'scriminal |
|---|
| 1358 | + | 134 historyrecordinformationfromtheFederalBureauof |
|---|
| 1359 | + | 135 Investigationandtheagencyresponsibleforretainingthat |
|---|
| 1360 | + | 136 state'scriminalrecords. |
|---|
| 1361 | + | 137 1.Amemberstatemustfullyimplementacriminalbackground |
|---|
| 1362 | + | 138 checkrequirement,withinatimeframeestablishedbyrule,by |
|---|
| 1363 | + | 139 receivingtheresultsoftheFederalBureauofInvestigation |
|---|
| 1364 | + | 140 recordsearchoncriminalbackgroundchecksandusetheresultsin |
|---|
| 1365 | + | 141 makinglicensuredecisions. |
|---|
| 1366 | + | 142 2.Communicationbetweenamemberstate,theCommissionand |
|---|
| 1367 | + | 143 amongmemberstatesregardingtheverificationofeligibilityfor |
|---|
| 1368 | + | 144 licensurethroughtheCompactshallnotincludeanyinformation |
|---|
| 1369 | + | 145 receivedfromtheFederalBureauofInvestigationrelatingtoa |
|---|
| 1370 | + | 146 federalcriminalrecordscheckperformedbyamemberstateunder |
|---|
| 1371 | + | 147 PublicLaw92-544. |
|---|
| 1372 | + | 148 C.Uponapplicationforaprivilegetopractice,the |
|---|
| 1373 | + | 149 licensingboardintheissuingremotestateshallascertain, |
|---|
| 1374 | + | 150 throughthedatasystem,whethertheapplicanthaseverheld,oris |
|---|
| 1375 | + | 151 theholderof,alicenseissuedbyanyotherstate,whetherthere |
|---|
| 1376 | + | 152 areanyencumbrancesonanylicenseorprivilegetopracticeheld |
|---|
| 1377 | + | 153 bytheapplicant,whetheranyadverseactionhasbeentakenagainst |
|---|
| 1378 | + | 154 anylicenseorprivilegetopracticeheldbytheapplicant. |
|---|
| 1379 | + | 155 D.Eachmemberstateshallrequireanapplicanttoobtainor |
|---|
| 1380 | + | 51 156 retainalicenseinthehomestateandmeetthehomestate's |
|---|
| 1381 | + | 157 qualificationsforlicensureorrenewaloflicensure,aswellas, |
|---|
| 1382 | + | 158 allotherapplicablestatelaws. |
|---|
| 1383 | + | 159 E.Foranaudiologist: |
|---|
| 1384 | + | 160 1.Mustmeetoneofthefollowingeducationalrequirements: |
|---|
| 1385 | + | 161 a.Onorbefore,Dec.31,2007,hasgraduatedwithamaster's |
|---|
| 1386 | + | 162 degreeordoctorateinaudiology,orequivalentdegreeregardless |
|---|
| 1387 | + | 163 ofdegreename,fromaprogramthatisaccreditedbyanaccrediting |
|---|
| 1388 | + | 164 agencyrecognizedbytheCouncilforHigherEducation |
|---|
| 1389 | + | 165 Accreditation,oritssuccessor,orbytheUnitedStates |
|---|
| 1390 | + | 166 DepartmentofEducationandoperatedbyacollegeoruniversity |
|---|
| 1391 | + | 167 accreditedbyaregionalornationalaccreditingorganization |
|---|
| 1392 | + | 168 recognizedbytheboard;or |
|---|
| 1393 | + | 169 b.Onorafter,Jan.1,2008,hasgraduatedwithaDoctoral |
|---|
| 1394 | + | 170 degreeinaudiology,orequivalentdegree,regardlessofdegree |
|---|
| 1395 | + | 171 name,fromaprogramthatisaccreditedbyanaccreditingagency |
|---|
| 1396 | + | 172 recognizedbytheCouncilforHigherEducationAccreditation,or |
|---|
| 1397 | + | 173 itssuccessor,orbytheUnitedStatesDepartmentofEducationand |
|---|
| 1398 | + | 174 operatedbyacollegeoruniversityaccreditedbyaregionalor |
|---|
| 1399 | + | 175 nationalaccreditingorganizationrecognizedbytheboard;or |
|---|
| 1400 | + | 176 c.Hasgraduatedfromanaudiologyprogramthatishousedin |
|---|
| 1401 | + | 177 aninstitutionofhighereducationoutsideoftheUnitedStates(a) |
|---|
| 1402 | + | 178 forwhichtheprogramandinstitutionhavebeenapprovedbythe |
|---|
| 1403 | + | 179 authorizedaccreditingbodyintheapplicablecountryand(b)the |
|---|
| 1404 | + | 180 degreeprogramhasbeenverifiedbyanindependentcredentials |
|---|
| 1405 | + | 181 reviewagencytobecomparabletoastatelicensingboard-approved |
|---|
| 1406 | + | 182 program. |
|---|
| 1407 | + | 52 183 2.Hascompletedasupervisedclinicalpracticumexperience |
|---|
| 1408 | + | 184 fromanaccreditededucationalinstitutionoritscooperating |
|---|
| 1409 | + | 185 programsasrequiredbytheCommission; |
|---|
| 1410 | + | 186 3.Hassuccessfullypassedanationalexaminationapproved |
|---|
| 1411 | + | 187 bytheCommission; |
|---|
| 1412 | + | 188 4.Holdsanactive,unencumberedlicense; |
|---|
| 1413 | + | 189 5.Hasnotbeenconvictedorfoundguilty,andhasnot |
|---|
| 1414 | + | 190 enteredintoanagreeddisposition,ofafelonyrelatedtothe |
|---|
| 1415 | + | 191 practiceofaudiology,underapplicablestateorfederalcriminal |
|---|
| 1416 | + | 192 law; |
|---|
| 1417 | + | 193 6.HasavalidUnitedStatesSocialSecurityorNational |
|---|
| 1418 | + | 194 PractitionerIdentificationnumber. |
|---|
| 1419 | + | 195 F.Foraspeech-language pathologist: |
|---|
| 1420 | + | 196 1.Mustmeetoneofthefollowingeducationalrequirements: |
|---|
| 1421 | + | 197 a.Hasgraduatedwithamaster'sdegreefromaspeech- |
|---|
| 1422 | + | 198 languagepathologyprogramthatisaccreditedbyanorganization |
|---|
| 1423 | + | 199 recognizedbytheUnitedStatesDepartmentofEducationand |
|---|
| 1424 | + | 200 operatedbyacollegeoruniversityaccreditedbyaregionalor |
|---|
| 1425 | + | 201 nationalaccreditingorganizationrecognizedbytheboard;or |
|---|
| 1426 | + | 202 b.Hasgraduatedfromaspeech-language pathologyprogram |
|---|
| 1427 | + | 203 thatishousedinaninstitutionofhighereducationoutsideofthe |
|---|
| 1428 | + | 204 UnitedStates(a)forwhichtheprogramandinstitutionhavebeen |
|---|
| 1429 | + | 205 approvedbytheauthorizedaccreditingbodyintheapplicable |
|---|
| 1430 | + | 206 countryand(b)thedegreeprogramhasbeenverifiedbyan |
|---|
| 1431 | + | 207 independentcredentialsreviewagencytobecomparabletoastate |
|---|
| 1432 | + | 208 licensingboard-approvedprogram. |
|---|
| 1433 | + | 209 2.Hascompletedasupervisedclinicalpracticumexperience |
|---|
| 1434 | + | 53 210 fromaneducationalinstitutionoritscooperatingprogramsas |
|---|
| 1435 | + | 211 requiredbytheCommission; |
|---|
| 1436 | + | 212 3.Hascompletedasupervisedpostgraduateprofessional |
|---|
| 1437 | + | 213 experienceasrequiredbytheCommission; |
|---|
| 1438 | + | 214 4.Hassuccessfullypassedanationalexaminationapproved |
|---|
| 1439 | + | 215 bytheCommission; |
|---|
| 1440 | + | 216 5.Holdsanactive,unencumberedlicense; |
|---|
| 1441 | + | 217 6.Hasnotbeenconvictedorfoundguilty,andhasnot |
|---|
| 1442 | + | 218 enteredintoanagreeddisposition,ofafelonyrelatedtothe |
|---|
| 1443 | + | 219 practiceofspeech-language pathology,underapplicablestateor |
|---|
| 1444 | + | 220 federalcriminallaw; |
|---|
| 1445 | + | 221 7.HasavalidUnitedStatesSocialSecurityorNational |
|---|
| 1446 | + | 222 PractitionerIdentificationnumber. |
|---|
| 1447 | + | 223 G.Theprivilegetopracticeisderivedfromthehomestate |
|---|
| 1448 | + | 224 license. |
|---|
| 1449 | + | 225 H.Anaudiologistorspeech-language pathologistpracticing |
|---|
| 1450 | + | 226 inamemberstatemustcomplywiththestatepracticelawsofthe |
|---|
| 1451 | + | 227 stateinwhichtheclientislocatedatthetimeserviceis |
|---|
| 1452 | + | 228 provided.Thepracticeofaudiologyandspeech-language pathology |
|---|
| 1453 | + | 229 shallincludeallaudiologyandspeech-language pathologypractice |
|---|
| 1454 | + | 230 asdefinedbythestatepracticelawsofthememberstateinwhich |
|---|
| 1455 | + | 231 theclientislocated.Thepracticeofaudiologyandspeech- |
|---|
| 1456 | + | 232 languagepathologyinamemberstateunderaprivilegetopractice |
|---|
| 1457 | + | 233 shallsubjectanaudiologistorspeech-language pathologisttothe |
|---|
| 1458 | + | 234 jurisdictionofthelicensingboard,thecourtsandthelawsofthe |
|---|
| 1459 | + | 235 memberstateinwhichtheclientislocatedatthetimeserviceis |
|---|
| 1460 | + | 236 provided. |
|---|
| 1461 | + | 54 237 I.Individualsnotresidinginamemberstateshallcontinue |
|---|
| 1462 | + | 238 tobeabletoapplyforamemberstate'ssingle-statelicenseas |
|---|
| 1463 | + | 239 providedunderthelawsofeachmemberstate.However,thesingle- |
|---|
| 1464 | + | 240 statelicensegrantedtotheseindividualsshallnotberecognized |
|---|
| 1465 | + | 241 asgrantingtheprivilegetopracticeaudiologyorspeech-language |
|---|
| 1466 | + | 242 pathologyinanyothermemberstate.NothinginthisCompactshall |
|---|
| 1467 | + | 243 affecttherequirementsestablishedbyamemberstateforthe |
|---|
| 1468 | + | 244 issuanceofasingle-statelicense. |
|---|
| 1469 | + | 245 J.Memberstatesmaychargeafeeforgrantingacompact |
|---|
| 1470 | + | 246 privilege. |
|---|
| 1471 | + | 247 K.Memberstatesmustcomplywiththebylawsandrulesand |
|---|
| 1472 | + | 248 regulationsoftheCommission. |
|---|
| 1473 | + | 249 SECTION4.COMPACTPRIVILEGE |
|---|
| 1474 | + | 250 A.Toexercisethecompactprivilegeunderthetermsand |
|---|
| 1475 | + | 251 provisionsoftheCompact,theaudiologistorspeech-language |
|---|
| 1476 | + | 252 pathologistshall: |
|---|
| 1477 | + | 253 1.Holdanactivelicenseinthehomestate; |
|---|
| 1478 | + | 254 2.Havenoencumbranceonanystatelicense; |
|---|
| 1479 | + | 255 3.Beeligibleforacompactprivilegeinanymemberstatein |
|---|
| 1480 | + | 256 accordancewithSection3; |
|---|
| 1481 | + | 257 4.Havenothadanyadverseactionagainstanylicenseor |
|---|
| 1482 | + | 258 compactprivilegewithintheprevious2yearsfromdateof |
|---|
| 1483 | + | 259 application; |
|---|
| 1484 | + | 260 5.NotifytheCommissionthatthelicenseeisseekingthe |
|---|
| 1485 | + | 261 compactprivilegewithinaremotestate(s); |
|---|
| 1486 | + | 262 6.Payanyapplicablefees,includinganystatefee,forthe |
|---|
| 1487 | + | 263 compactprivilege; |
|---|
| 1488 | + | 55 264 7.ReporttotheCommissionadverseactiontakenbyanynon- |
|---|
| 1489 | + | 265 memberstatewithin30daysfromthedatetheadverseactionis |
|---|
| 1490 | + | 266 taken. |
|---|
| 1491 | + | 267 B.Forthepurposesofthecompactprivilege,anaudiologist |
|---|
| 1492 | + | 268 orspeech-language pathologistshallonlyholdonehomestate |
|---|
| 1493 | + | 269 licenseatatime. |
|---|
| 1494 | + | 270 C.ExceptasprovidedinSection6,ifanaudiologistor |
|---|
| 1495 | + | 271 speech-language pathologistchangesprimarystateofresidenceby |
|---|
| 1496 | + | 272 movingbetweentwo-memberstates,theaudiologistorspeech- |
|---|
| 1497 | + | 273 languagepathologistmustapplyforlicensureinthenewhome |
|---|
| 1498 | + | 274 state,andthelicenseissuedbythepriorhomestateshallbe |
|---|
| 1499 | + | 275 deactivatedinaccordancewithapplicablerulesadoptedbythe |
|---|
| 1500 | + | 276 Commission. |
|---|
| 1501 | + | 277 D.Theaudiologistorspeech-language pathologistmayapply |
|---|
| 1502 | + | 278 forlicensureinadvanceofachangeinprimarystateofresidence. |
|---|
| 1503 | + | 279 E.Alicenseshallnotbeissuedbythenewhomestateuntil |
|---|
| 1504 | + | 280 theaudiologistorspeech-language pathologistprovides |
|---|
| 1505 | + | 281 satisfactoryevidenceofachangeinprimarystateofresidenceto |
|---|
| 1506 | + | 282 thenewhomestateandsatisfiesallapplicablerequirementsto |
|---|
| 1507 | + | 283 obtainalicensefromthenewhomestate. |
|---|
| 1508 | + | 284 F.Ifanaudiologistorspeech-language pathologistchanges |
|---|
| 1509 | + | 285 primarystateofresidencebymovingfromamemberstatetoanon- |
|---|
| 1510 | + | 286 memberstate,thelicenseissuedbythepriorhomestateshall |
|---|
| 1511 | + | 287 converttoasingle-statelicense,validonlyintheformerhome |
|---|
| 1512 | + | 288 state. |
|---|
| 1513 | + | 289 G.Thecompactprivilegeisvaliduntiltheexpirationdate |
|---|
| 1514 | + | 290 ofthehomestatelicense.Thelicenseemustcomplywiththe |
|---|
| 1515 | + | 56 291 requirementsofSection4Atomaintainthecompactprivilegeinthe |
|---|
| 1516 | + | 292 remotestate. |
|---|
| 1517 | + | 293 H.Alicenseeprovidingaudiologyorspeech-language |
|---|
| 1518 | + | 294 pathologyservicesinaremotestateunderthecompactprivilege |
|---|
| 1519 | + | 295 shallfunctionwithinthelawsandregulationsoftheremotestate. |
|---|
| 1520 | + | 296 I.Alicenseeprovidingaudiologyorspeech-language |
|---|
| 1521 | + | 297 pathologyservicesinaremotestateissubjecttothatstate's |
|---|
| 1522 | + | 298 regulatoryauthority. Aremotestatemay,inaccordancewithdue |
|---|
| 1523 | + | 299 processandthatstate'slaws,removealicensee'scompact |
|---|
| 1524 | + | 300 privilegeintheremotestateforaspecificperiodoftime,impose |
|---|
| 1525 | + | 301 fines,and/ortakeanyothernecessaryactionstoprotectthe |
|---|
| 1526 | + | 302 healthandsafetyofitscitizens. |
|---|
| 1527 | + | 303 J.Ifahomestatelicenseisencumbered,thelicenseeshall |
|---|
| 1528 | + | 304 losethecompactprivilegeinanyremotestateuntilthefollowing |
|---|
| 1529 | + | 305 occur: |
|---|
| 1530 | + | 306 1.Thehomestatelicenseisnolongerencumbered;and |
|---|
| 1531 | + | 307 2.Twoyearshaveelapsedfromthedateoftheadverse |
|---|
| 1532 | + | 308 action. |
|---|
| 1533 | + | 309 K.Onceanencumberedlicenseinthehomestateisrestored |
|---|
| 1534 | + | 310 togoodstanding,thelicenseemustmeettherequirementsof |
|---|
| 1535 | + | 311 Section4Atoobtainacompactprivilegeinanyremotestate. |
|---|
| 1536 | + | 312 L.OncetherequirementsofSection4Jhavebeenmet,the |
|---|
| 1537 | + | 313 licenseemustmeettherequirementsinSection4Atoobtaina |
|---|
| 1538 | + | 314 compactprivilegeinaremotestate. |
|---|
| 1539 | + | 315 SECTION5.COMPACTPRIVILEGETOPRACTICETELEHEALTH |
|---|
| 1540 | + | 316 Memberstatesshallrecognizetherightofanaudiologistor |
|---|
| 1541 | + | 317 speech-language pathologist,licensedbyahomestatein |
|---|
| 1542 | + | 57 318 accordancewithSection3andunderrulespromulgatedbythe |
|---|
| 1543 | + | 319 Commission,topracticeaudiologyorspeech-language pathologyin |
|---|
| 1544 | + | 320 anymemberstateviatelehealthunderaprivilegetopracticeas |
|---|
| 1545 | + | 321 providedintheCompactandrulespromulgatedbytheCommission. |
|---|
| 1546 | + | 322 SECTION6.ACTIVEDUTYMILITARYPERSONNELORTHEIRSPOUSES |
|---|
| 1547 | + | 323 Activedutymilitarypersonnel,ortheirspouse,shall |
|---|
| 1548 | + | 324 designateahomestatewheretheindividualhasacurrentlicense |
|---|
| 1549 | + | 325 ingoodstanding. Theindividualmayretainthehomestate |
|---|
| 1550 | + | 326 designationduringtheperiodtheservicememberisonactiveduty. |
|---|
| 1551 | + | 327 Subsequenttodesignatingahomestate,theindividualshallonly |
|---|
| 1552 | + | 328 changetheirhomestatethroughapplicationforlicensureinthe |
|---|
| 1553 | + | 329 newstate. |
|---|
| 1554 | + | 330 SECTION7.ADVERSEACTIONS |
|---|
| 1555 | + | 331 A.Inadditiontotheotherpowersconferredbystatelaw,a |
|---|
| 1556 | + | 332 remotestateshallhavetheauthority,inaccordancewithexisting |
|---|
| 1557 | + | 333 statedueprocesslaw,to: |
|---|
| 1558 | + | 334 1.Takeadverseactionagainstanaudiologist'sorspeech- |
|---|
| 1559 | + | 335 languagepathologist'sprivilegetopracticewithinthatmember |
|---|
| 1560 | + | 336 state. |
|---|
| 1561 | + | 337 2.Issuesubpoenasforbothhearingsandinvestigationsthat |
|---|
| 1562 | + | 338 requiretheattendanceandtestimonyofwitnessesaswellasthe |
|---|
| 1563 | + | 339 productionofevidence.Subpoenasissuedbyalicensingboardina |
|---|
| 1564 | + | 340 memberstatefortheattendanceandtestimonyofwitnessesorthe |
|---|
| 1565 | + | 341 productionofevidencefromanothermemberstateshallbeenforced |
|---|
| 1566 | + | 342 inthelatterstatebyanycourtofcompetentjurisdiction, |
|---|
| 1567 | + | 343 accordingtothepracticeandprocedureofthatcourtapplicableto |
|---|
| 1568 | + | 344 subpoenasissuedinproceedingspendingbeforeit.Theissuing |
|---|
| 1569 | + | 58 345 authorityshallpayanywitnessfees,travelexpenses,mileageand |
|---|
| 1570 | + | 346 otherfeesrequiredbytheservicestatutesofthestateinwhich |
|---|
| 1571 | + | 347 thewitnessesorevidencearelocated. |
|---|
| 1572 | + | 348 3.Onlythehomestateshallhavethepowertotakeadverse |
|---|
| 1573 | + | 349 actionagainstanaudiologist'sorspeech-language pathologist's |
|---|
| 1574 | + | 350 licenseissuedbythehomestate. |
|---|
| 1575 | + | 351 B.Forpurposesoftakingadverseaction,thehomestate |
|---|
| 1576 | + | 352 shallgivethesamepriorityandeffecttoreportedconduct |
|---|
| 1577 | + | 353 receivedfromamemberstateasitwouldiftheconducthad |
|---|
| 1578 | + | 354 occurredwithinthehomestate.Insodoing,thehomestateshall |
|---|
| 1579 | + | 355 applyitsownstatelawstodetermineappropriateaction. |
|---|
| 1580 | + | 356 C.Thehomestateshallcompleteanypendinginvestigations |
|---|
| 1581 | + | 357 ofanaudiologistorspeech-language pathologistwhochanges |
|---|
| 1582 | + | 358 primarystateofresidenceduringthecourseofthe |
|---|
| 1583 | + | 359 investigations. Thehomestateshallalsohavetheauthorityto |
|---|
| 1584 | + | 360 takeappropriateaction(s)andshallpromptlyreportthe |
|---|
| 1585 | + | 361 conclusionsoftheinvestigationstotheadministratorofthedata |
|---|
| 1586 | + | 362 system.Theadministratorofthecoordinatedlicensure |
|---|
| 1587 | + | 363 informationsystemshallpromptlynotifythenewhomestateofany |
|---|
| 1588 | + | 364 adverseactions. |
|---|
| 1589 | + | 365 D.Ifotherwisepermittedbystatelaw,thememberstatemay |
|---|
| 1590 | + | 366 recoverfromtheaffectedaudiologistorspeech-language |
|---|
| 1591 | + | 367 pathologistthecostsofinvestigationsanddispositionofcases |
|---|
| 1592 | + | 368 resultingfromanyadverseactiontakenagainstthataudiologist |
|---|
| 1593 | + | 369 orspeech-language pathologist. |
|---|
| 1594 | + | 370 E.Thememberstatemaytakeadverseactionbasedonthe |
|---|
| 1595 | + | 371 factualfindingsoftheremotestate,providedthatthemember |
|---|
| 1596 | + | 59 372 statefollowsthememberstate'sownproceduresfortakingthe |
|---|
| 1597 | + | 373 adverseaction. |
|---|
| 1598 | + | 374 F.JointInvestigations: |
|---|
| 1599 | + | 375 1.Inadditiontotheauthoritygrantedtoamemberstateby |
|---|
| 1600 | + | 376 itsrespectiveaudiologyorspeech-language pathologypracticeact |
|---|
| 1601 | + | 377 orotherapplicablestatelaw,anymemberstatemayparticipate |
|---|
| 1602 | + | 378 withothermemberstatesinjointinvestigationsoflicensees. |
|---|
| 1603 | + | 379 2.Memberstatesshallshareanyinvestigative,litigation, |
|---|
| 1604 | + | 380 orcompliancematerialsinfurtheranceofanyjointorindividual |
|---|
| 1605 | + | 381 investigationinitiatedundertheCompact. |
|---|
| 1606 | + | 382 G.Ifadverseactionistakenbythehomestateagainstan |
|---|
| 1607 | + | 383 audiologist'sorspeech-language pathologist'slicense,the |
|---|
| 1608 | + | 384 audiologist'sorspeech-language pathologist'sprivilegeto |
|---|
| 1609 | + | 385 practiceinallothermemberstatesshallbedeactivateduntilall |
|---|
| 1610 | + | 386 encumbranceshavebeenremovedfromthestatelicense.Allhome |
|---|
| 1611 | + | 387 statedisciplinaryordersthatimposeadverseactionagainstan |
|---|
| 1612 | + | 388 audiologist'sorspeech-language pathologist'slicenseshall |
|---|
| 1613 | + | 389 includeastatementthattheaudiologist'sorspeech-language |
|---|
| 1614 | + | 390 pathologist'sprivilegetopracticeisdeactivatedinallmember |
|---|
| 1615 | + | 391 statesduringthependencyoftheorder. |
|---|
| 1616 | + | 392 H.Ifamemberstatetakesadverseaction,itshallpromptly |
|---|
| 1617 | + | 393 notifytheadministratorofthedatasystem.Theadministratorof |
|---|
| 1618 | + | 394 thedatasystemshallpromptlynotifythehomestateofanyadverse |
|---|
| 1619 | + | 395 actionsbyremotestates. |
|---|
| 1620 | + | 396 I.NothinginthisCompactshalloverrideamemberstate's |
|---|
| 1621 | + | 397 decisionthatparticipationinanalternativeprogrammaybeused |
|---|
| 1622 | + | 398 inlieuofadverseaction. |
|---|
| 1623 | + | 60 399 SECTION8.ESTABLISHMENTOFTHEAUDIOLOGYANDSPEECH- |
|---|
| 1624 | + | 400 LANGUAGEPATHOLOGYCOMPACTCOMMISSION |
|---|
| 1625 | + | 401 A.TheCompactmemberstatesherebycreateandestablisha |
|---|
| 1626 | + | 402 jointpublicagencyknownastheAudiologyandSpeech-Language |
|---|
| 1627 | + | 403 PathologyCompactCommission: |
|---|
| 1628 | + | 404 1.TheCommissionisaninstrumentality oftheCompact |
|---|
| 1629 | + | 405 states. |
|---|
| 1630 | + | 406 2.Venueisproperandjudicialproceedingsbyoragainstthe |
|---|
| 1631 | + | 407 Commissionshallbebroughtsolelyandexclusivelyinacourtof |
|---|
| 1632 | + | 408 competentjurisdictionwheretheprincipalofficeofthe |
|---|
| 1633 | + | 409 Commissionislocated.TheCommissionmaywaivevenueand |
|---|
| 1634 | + | 410 jurisdictionaldefensestotheextentitadoptsorconsentsto |
|---|
| 1635 | + | 411 participateinalternativedisputeresolutionproceedings. |
|---|
| 1636 | + | 412 3.NothinginthisCompactshallbeconstruedtobeawaiver |
|---|
| 1637 | + | 413 ofsovereignimmunity. |
|---|
| 1638 | + | 414 B.Membership,VotingandMeetings: |
|---|
| 1639 | + | 415 1.Eachmemberstateshallhavetwo(2)delegatesselectedby |
|---|
| 1640 | + | 416 thatmemberstate'slicensingboard.Thedelegatesshallbe |
|---|
| 1641 | + | 417 currentmembersofthelicensingboard.Oneshallbean |
|---|
| 1642 | + | 418 audiologistandoneshallbeaspeech-language pathologist. |
|---|
| 1643 | + | 419 2.Anadditionalfive(5)delegates,whoareeitherapublic |
|---|
| 1644 | + | 420 memberorboardadministratorfromastatelicensingboard,shall |
|---|
| 1645 | + | 421 bechosenbytheExecutiveCommitteefromapoolofnominees |
|---|
| 1646 | + | 422 providedbytheCommissionatLarge. |
|---|
| 1647 | + | 423 3.Anydelegatemayberemovedorsuspendedfromofficeas |
|---|
| 1648 | + | 424 providedbythelawofthestatefromwhichthedelegateis |
|---|
| 1649 | + | 425 appointed. |
|---|
| 1650 | + | 61 426 4.Thememberstateboardshallfillanyvacancyoccurringon |
|---|
| 1651 | + | 427 theCommission,within90days. |
|---|
| 1652 | + | 428 5.Eachdelegateshallbeentitledtoone(1)votewith |
|---|
| 1653 | + | 429 regardtothepromulgationofrulesandcreationofbylawsand |
|---|
| 1654 | + | 430 shallotherwisehaveanopportunitytoparticipateinthebusiness |
|---|
| 1655 | + | 431 andaffairsoftheCommission. |
|---|
| 1656 | + | 432 6.Adelegateshallvoteinpersonorbyothermeansas |
|---|
| 1657 | + | 433 providedinthebylaws.Thebylawsmayprovidefordelegates' |
|---|
| 1658 | + | 434 participationinmeetingsbytelephoneorothermeansof |
|---|
| 1659 | + | 435 communication. |
|---|
| 1660 | + | 436 7.TheCommissionshallmeetatleastonceduringeach |
|---|
| 1661 | + | 437 calendaryear.Additionalmeetingsshallbeheldassetforthin |
|---|
| 1662 | + | 438 thebylaws. |
|---|
| 1663 | + | 439 C.TheCommissionshallhavethefollowingpowersandduties: |
|---|
| 1664 | + | 440 1.EstablishthefiscalyearoftheCommission; |
|---|
| 1665 | + | 441 2.Establishbylaws; |
|---|
| 1666 | + | 442 3.EstablishaCodeofEthics; |
|---|
| 1667 | + | 443 4.Maintainitsfinancialrecordsinaccordancewiththe |
|---|
| 1668 | + | 444 bylaws; |
|---|
| 1669 | + | 445 5.Meetandtakeactionsasareconsistentwiththe |
|---|
| 1670 | + | 446 provisionsofthisCompactandthebylaws; |
|---|
| 1671 | + | 447 6.Promulgateuniformrulestofacilitateandcoordinate |
|---|
| 1672 | + | 448 implementationandadministrationofthisCompact.Therules |
|---|
| 1673 | + | 449 shallhavetheforceandeffectoflawandshallbebindinginall |
|---|
| 1674 | + | 450 memberstates; |
|---|
| 1675 | + | 451 7.Bringandprosecutelegalproceedingsoractionsinthe |
|---|
| 1676 | + | 452 nameoftheCommission,providedthatthestandingofanystate |
|---|
| 1677 | + | 62 453 audiologyorspeech-language pathologylicensingboardtosueor |
|---|
| 1678 | + | 454 besuedunderapplicablelawshallnotbeaffected; |
|---|
| 1679 | + | 455 8.Purchaseandmaintaininsuranceandbonds; |
|---|
| 1680 | + | 456 9.Borrow,accept,orcontractforservicesofpersonnel, |
|---|
| 1681 | + | 457 including,butnotlimitedto,employeesofamemberstate; |
|---|
| 1682 | + | 458 10.Hireemployees,electorappointofficers,fix |
|---|
| 1683 | + | 459 compensation,defineduties,grantindividualsappropriate |
|---|
| 1684 | + | 460 authoritytocarryoutthepurposesoftheCompact,andto |
|---|
| 1685 | + | 461 establishtheCommission'spersonnelpoliciesandprograms |
|---|
| 1686 | + | 462 relatingtoconflictsofinterest,qualificationsofpersonnel, |
|---|
| 1687 | + | 463 andotherrelatedpersonnelmatters; |
|---|
| 1688 | + | 464 11.Acceptanyandallappropriatedonationsandgrantsof |
|---|
| 1689 | + | 465 money,equipment,supplies,materialsandservices,andto |
|---|
| 1690 | + | 466 receive,utilizeanddisposeofthesame;providedthatatall |
|---|
| 1691 | + | 467 timestheCommissionshallavoidanyappearanceofimpropriety |
|---|
| 1692 | + | 468 and/orconflictofinterest; |
|---|
| 1693 | + | 469 12.Lease,purchase,acceptappropriategiftsordonations |
|---|
| 1694 | + | 470 of,orotherwisetoown,hold,improveoruse,anyproperty,real, |
|---|
| 1695 | + | 471 personalormixed;providedthatatalltimestheCommissionshall |
|---|
| 1696 | + | 472 avoidanyappearanceofimpropriety; |
|---|
| 1697 | + | 473 13.Sell,convey,mortgage,pledge,lease,exchange, |
|---|
| 1698 | + | 474 abandon,orotherwisedisposeofanypropertyreal,personal,or |
|---|
| 1699 | + | 475 mixed; |
|---|
| 1700 | + | 476 14.Establishabudgetandmakeexpenditures; |
|---|
| 1701 | + | 477 15.Borrowmoney; |
|---|
| 1702 | + | 478 16.Appointcommittees,includingstandingcommittees |
|---|
| 1703 | + | 479 composedofmembers,andotherinterestedpersonsasmaybe |
|---|
| 1704 | + | 63 480 designatedinthisCompactandthebylaws; |
|---|
| 1705 | + | 481 17.Provideandreceiveinformationfrom,andcooperate |
|---|
| 1706 | + | 482 with,lawenforcementagencies; |
|---|
| 1707 | + | 483 18.EstablishandelectanExecutiveCommittee;and |
|---|
| 1708 | + | 484 19.Performotherfunctionsasmaybenecessaryor |
|---|
| 1709 | + | 485 appropriatetoachievethepurposesofthisCompactconsistent |
|---|
| 1710 | + | 486 withthestateregulationofaudiologyandspeech-language |
|---|
| 1711 | + | 487 pathologylicensureandpractice. |
|---|
| 1712 | + | 488 D.TheExecutiveCommittee |
|---|
| 1713 | + | 489 TheExecutiveCommitteeshallhavethepowertoactonbehalf |
|---|
| 1714 | + | 490 oftheCommissionaccordingtothetermsofthisCompact: |
|---|
| 1715 | + | 491 1.TheExecutiveCommitteeshallbecomposedoften(10) |
|---|
| 1716 | + | 492 members: |
|---|
| 1717 | + | 493 a.Seven(7)votingmemberswhoareelectedbytheCommission |
|---|
| 1718 | + | 494 fromthecurrentmembershipoftheCommission; |
|---|
| 1719 | + | 495 b.Two(2)ex-officios,consistingofonenonvotingmember |
|---|
| 1720 | + | 496 fromarecognizednationalaudiologyprofessionalassociationand |
|---|
| 1721 | + | 497 onenonvotingmemberfromarecognizednationalspeech-language |
|---|
| 1722 | + | 498 pathologyassociation;and |
|---|
| 1723 | + | 499 c.One(1)ex-officio,nonvotingmemberfromtherecognized |
|---|
| 1724 | + | 500 membershiporganizationoftheaudiologyandspeech-language |
|---|
| 1725 | + | 501 pathologylicensingboards. |
|---|
| 1726 | + | 502 E.Theex-officiomembersshallbeselectedbytheir |
|---|
| 1727 | + | 503 respectiveorganizations. |
|---|
| 1728 | + | 504 1.TheCommissionmayremoveanymemberoftheExecutive |
|---|
| 1729 | + | 505 Committeeasprovidedinbylaws. |
|---|
| 1730 | + | 506 2.TheExecutiveCommitteeshallmeetatleastannually. |
|---|
| 1731 | + | 64 507 3.TheExecutiveCommitteeshallhavethefollowingduties |
|---|
| 1732 | + | 508 andresponsibilities: |
|---|
| 1733 | + | 509 a.RecommendtotheentireCommissionchangestotherulesor |
|---|
| 1734 | + | 510 bylaws,changestothisCompactlegislation,feespaidbyCompact |
|---|
| 1735 | + | 511 memberstatessuchasannualdues,andanycommissionCompactfee |
|---|
| 1736 | + | 512 chargedtolicenseesforthecompactprivilege; |
|---|
| 1737 | + | 513 b.EnsureCompactadministrationservicesareappropriately |
|---|
| 1738 | + | 514 provided,contractualorotherwise; |
|---|
| 1739 | + | 515 c.Prepareandrecommendthebudget; |
|---|
| 1740 | + | 516 d.MaintainfinancialrecordsonbehalfoftheCommission; |
|---|
| 1741 | + | 517 e.MonitorCompactcomplianceofmemberstatesandprovide |
|---|
| 1742 | + | 518 compliancereportstotheCommission; |
|---|
| 1743 | + | 519 f.Establishadditionalcommitteesasnecessary;and |
|---|
| 1744 | + | 520 g.Otherdutiesasprovidedinrulesorbylaws. |
|---|
| 1745 | + | 521 4.MeetingsoftheCommission |
|---|
| 1746 | + | 522 Allmeetingsshallbeopentothepublic,andpublicnoticeof |
|---|
| 1747 | + | 523 meetingsshallbegiveninthesamemannerasrequiredunderthe |
|---|
| 1748 | + | 524 rulemakingprovisionsinSection10. |
|---|
| 1749 | + | 525 5.TheCommissionortheExecutiveCommitteeorother |
|---|
| 1750 | + | 526 committeesoftheCommissionmayconveneinaclosed,non-public |
|---|
| 1751 | + | 527 meetingiftheCommissionorExecutiveCommitteeorother |
|---|
| 1752 | + | 528 committeesoftheCommissionmustdiscuss: |
|---|
| 1753 | + | 529 a.Non-complianceofamemberstatewithitsobligations |
|---|
| 1754 | + | 530 undertheCompact; |
|---|
| 1755 | + | 531 b.Theemployment,compensation,disciplineorother |
|---|
| 1756 | + | 532 matters,practicesorproceduresrelatedtospecificemployeesor |
|---|
| 1757 | + | 533 othermattersrelatedtotheCommission'sinternalpersonnel |
|---|
| 1758 | + | 65 534 practicesandprocedures; |
|---|
| 1759 | + | 535 c.Current,threatened,orreasonablyanticipated |
|---|
| 1760 | + | 536 litigation; |
|---|
| 1761 | + | 537 d.Negotiationofcontractsforthepurchase,lease,orsale |
|---|
| 1762 | + | 538 ofgoods,services,orrealestate; |
|---|
| 1763 | + | 539 e.Accusinganypersonofacrimeorformallycensuringany |
|---|
| 1764 | + | 540 person; |
|---|
| 1765 | + | 541 f.Disclosureoftradesecretsorcommercialorfinancial |
|---|
| 1766 | + | 542 informationthatisprivilegedorconfidential; |
|---|
| 1767 | + | 543 g.Disclosureofinformationofapersonalnaturewhere |
|---|
| 1768 | + | 544 disclosurewouldconstituteaclearlyunwarrantedinvasionof |
|---|
| 1769 | + | 545 personalprivacy; |
|---|
| 1770 | + | 546 h.Disclosureofinvestigativerecordscompiledforlaw |
|---|
| 1771 | + | 547 enforcementpurposes; |
|---|
| 1772 | + | 548 i.Disclosureofinformationrelatedtoanyinvestigative |
|---|
| 1773 | + | 549 reportspreparedbyoronbehalfoforforuseoftheCommissionor |
|---|
| 1774 | + | 550 othercommitteechargedwithresponsibilityofinvestigationor |
|---|
| 1775 | + | 551 determinationofcomplianceissuespursuanttotheCompact;or |
|---|
| 1776 | + | 552 j.Mattersspecificallyexemptedfromdisclosurebyfederal |
|---|
| 1777 | + | 553 ormemberstatestatute. |
|---|
| 1778 | + | 554 6.Ifameeting,orportionofameeting,isclosedpursuant |
|---|
| 1779 | + | 555 tothisprovision,theCommission'slegalcounselordesignee |
|---|
| 1780 | + | 556 shallcertifythatthemeetingmaybeclosedandshallreference |
|---|
| 1781 | + | 557 eachrelevantexemptingprovision. |
|---|
| 1782 | + | 558 7.TheCommissionshallkeepminutesthatfullyandclearly |
|---|
| 1783 | + | 559 describeallmattersdiscussedinameetingandshallprovidea |
|---|
| 1784 | + | 560 fullandaccuratesummaryofactionstaken,andthereasons |
|---|
| 1785 | + | 66 561 therefore,includingadescriptionoftheviewsexpressed. All |
|---|
| 1786 | + | 562 documentsconsideredinconnectionwithanactionshallbe |
|---|
| 1787 | + | 563 identifiedinminutes.Allminutesanddocumentsofaclosed |
|---|
| 1788 | + | 564 meetingshallremainunderseal,subjecttoreleasebyamajority |
|---|
| 1789 | + | 565 voteoftheCommissionororderofacourtofcompetent |
|---|
| 1790 | + | 566 jurisdiction. |
|---|
| 1791 | + | 567 8.FinancingoftheCommission: |
|---|
| 1792 | + | 568 a.TheCommissionshallpay,orprovideforthepaymentof, |
|---|
| 1793 | + | 569 thereasonableexpensesofitsestablishment,organization,and |
|---|
| 1794 | + | 570 ongoingactivities. |
|---|
| 1795 | + | 571 b.TheCommissionmayacceptanyandallappropriaterevenue |
|---|
| 1796 | + | 572 sources,donations,andgrantsofmoney,equipment,supplies, |
|---|
| 1797 | + | 573 materials,andservices. |
|---|
| 1798 | + | 574 c.TheCommissionmaylevyonandcollectanannual |
|---|
| 1799 | + | 575 assessmentfromeachmemberstateorimposefeesonotherparties |
|---|
| 1800 | + | 576 tocoverthecostoftheoperationsandactivitiesofthe |
|---|
| 1801 | + | 577 Commissionanditsstaff,whichmustbeinatotalamount |
|---|
| 1802 | + | 578 sufficienttocoveritsannualbudgetasapprovedeachyearfor |
|---|
| 1803 | + | 579 whichrevenueisnotprovidedbyothersources.Theaggregate |
|---|
| 1804 | + | 580 annualassessmentamountshallbeallocatedbaseduponaformulato |
|---|
| 1805 | + | 581 bedeterminedbytheCommission,whichshallpromulgatearule |
|---|
| 1806 | + | 582 bindinguponallmemberstates. |
|---|
| 1807 | + | 583 9.TheCommissionshallnotincurobligationsofanykind |
|---|
| 1808 | + | 584 priortosecuringthefundsadequatetomeetthesame;norshall |
|---|
| 1809 | + | 585 theCommissionpledgethecreditofanyofthememberstates, |
|---|
| 1810 | + | 586 exceptbyandwiththeauthorityofthememberstate. |
|---|
| 1811 | + | 587 10.TheCommissionshallkeepaccurateaccountsofall |
|---|
| 1812 | + | 67 588 receiptsanddisbursements. Thereceiptsanddisbursementsofthe |
|---|
| 1813 | + | 589 Commissionshallbesubjecttotheauditandaccountingprocedures |
|---|
| 1814 | + | 590 establishedunderitsbylaws.However,allreceiptsand |
|---|
| 1815 | + | 591 disbursementsoffundshandledbytheCommissionshallbeaudited |
|---|
| 1816 | + | 592 yearlybyacertifiedorlicensedpublicaccountant,andthereport |
|---|
| 1817 | + | 593 oftheauditshallbeincludedinandbecomepartoftheannual |
|---|
| 1818 | + | 594 reportoftheCommission. |
|---|
| 1819 | + | 595 F.QualifiedImmunity,Defense,andIndemnification: |
|---|
| 1820 | + | 596 1.Themembers,officers,executivedirector,employeesand |
|---|
| 1821 | + | 597 representatives oftheCommissionshallbeimmunefromsuitand |
|---|
| 1822 | + | 598 liability,eitherpersonallyorintheirofficialcapacity,for |
|---|
| 1823 | + | 599 anyclaimfordamagetoorlossofpropertyorpersonalinjuryor |
|---|
| 1824 | + | 600 othercivilliabilitycausedbyorarisingoutofanyactualor |
|---|
| 1825 | + | 601 allegedact,errororomissionthatoccurred,orthattheperson |
|---|
| 1826 | + | 602 againstwhomtheclaimismadehadareasonablebasisforbelieving |
|---|
| 1827 | + | 603 occurredwithinthescopeofCommissionemployment,dutiesor |
|---|
| 1828 | + | 604 responsibilities; providedthatnothinginthisparagraphshallbe |
|---|
| 1829 | + | 605 construedtoprotectanypersonfromsuitand/orliabilityforany |
|---|
| 1830 | + | 606 damage,loss,injury,orliabilitycausedbytheintentionalor |
|---|
| 1831 | + | 607 willfulorwantonmisconductofthatperson. |
|---|
| 1832 | + | 608 2.TheCommissionshalldefendanymember,officer, |
|---|
| 1833 | + | 609 executivedirector,employeeorrepresentativeoftheCommission |
|---|
| 1834 | + | 610 inanycivilactionseekingtoimposeliabilityarisingoutofany |
|---|
| 1835 | + | 611 actualorallegedact,error,oromissionthatoccurredwithinthe |
|---|
| 1836 | + | 612 scopeofCommissionemployment,duties,orresponsibilities, or |
|---|
| 1837 | + | 613 thatthepersonagainstwhomtheclaimismadehadareasonable |
|---|
| 1838 | + | 614 basisforbelievingoccurredwithinthescopeofCommission |
|---|
| 1839 | + | 68 615 employment,duties,orresponsibilities; providedthatnothing |
|---|
| 1840 | + | 616 hereinshallbeconstruedtoprohibitthatpersonfromretaining |
|---|
| 1841 | + | 617 hisorherowncounsel;andprovidedfurther,thattheactualor |
|---|
| 1842 | + | 618 allegedact,error,oromissiondidnotresultfromthatperson's |
|---|
| 1843 | + | 619 intentionalorwillfulorwantonmisconduct. |
|---|
| 1844 | + | 620 3.TheCommissionshallindemnifyandholdharmlessany |
|---|
| 1845 | + | 621 member,officer,executivedirector,employee,orrepresentative |
|---|
| 1846 | + | 622 oftheCommissionfortheamountofanysettlementorjudgment |
|---|
| 1847 | + | 623 obtainedagainstthatpersonarisingoutofanyactualoralleged |
|---|
| 1848 | + | 624 act,errororomissionthatoccurredwithinthescopeofCommission |
|---|
| 1849 | + | 625 employment,duties,orresponsibilities, orthatpersonhada |
|---|
| 1850 | + | 626 reasonablebasisforbelievingoccurredwithinthescopeof |
|---|
| 1851 | + | 627 Commissionemployment,duties,orresponsibilities, providedthat |
|---|
| 1852 | + | 628 theactualorallegedact,error,oromissiondidnotresultfrom |
|---|
| 1853 | + | 629 theintentionalorwillfulorwantonmisconductofthatperson. |
|---|
| 1854 | + | 630 SECTION9.DATASYSTEM |
|---|
| 1855 | + | 631 A.TheCommissionshallprovideforthedevelopment, |
|---|
| 1856 | + | 632 maintenance,andutilizationofacoordinateddatabaseand |
|---|
| 1857 | + | 633 reportingsystemcontaininglicensure,adverseaction,and |
|---|
| 1858 | + | 634 investigativeinformationonalllicensedindividualsinmember |
|---|
| 1859 | + | 635 states. |
|---|
| 1860 | + | 636 B.Notwithstanding anyotherprovisionofstatelawtothe |
|---|
| 1861 | + | 637 contrary,amemberstateshallsubmitauniformdatasettothe |
|---|
| 1862 | + | 638 datasystemonallindividualstowhomthisCompactisapplicable |
|---|
| 1863 | + | 639 asrequiredbytherulesoftheCommission,including: |
|---|
| 1864 | + | 640 1.Identifyinginformation; |
|---|
| 1865 | + | 641 2.Licensuredata; |
|---|
| 1866 | + | 69 642 3.Adverseactionsagainstalicenseorcompactprivilege; |
|---|
| 1867 | + | 643 4.Non-confidential informationrelatedtoalternative |
|---|
| 1868 | + | 644 programparticipation; |
|---|
| 1869 | + | 645 5.Anydenialofapplicationforlicensure,andthereason(s) |
|---|
| 1870 | + | 646 fordenial;and |
|---|
| 1871 | + | 647 6.Otherinformationthatmayfacilitatetheadministration |
|---|
| 1872 | + | 648 ofthisCompact,asdeterminedbytherulesoftheCommission. |
|---|
| 1873 | + | 649 C.Investigativeinformationpertainingtoalicenseeinany |
|---|
| 1874 | + | 650 memberstateshallonlybeavailabletoothermemberstates. |
|---|
| 1875 | + | 651 D.TheCommissionshallpromptlynotifyallmemberstatesof |
|---|
| 1876 | + | 652 anyadverseactiontakenagainstalicenseeoranindividual |
|---|
| 1877 | + | 653 applyingforalicense.Adverseactioninformationpertainingtoa |
|---|
| 1878 | + | 654 licenseeinanymemberstateshallbeavailabletoanyothermember |
|---|
| 1879 | + | 655 state. |
|---|
| 1880 | + | 656 E.Memberstatescontributinginformationtothedatasystem |
|---|
| 1881 | + | 657 maydesignateinformationthatmaynotbesharedwiththepublic |
|---|
| 1882 | + | 658 withouttheexpresspermissionofthecontributingstate. |
|---|
| 1883 | + | 659 F.Anyinformationsubmittedtothedatasystemthatis |
|---|
| 1884 | + | 660 subsequentlyrequiredtobeexpungedbythelawsofthemember |
|---|
| 1885 | + | 661 statecontributingtheinformationshallberemovedfromthedata |
|---|
| 1886 | + | 662 system. |
|---|
| 1887 | + | 663 SECTION10.RULEMAKING |
|---|
| 1888 | + | 664 A.TheCommissionshallexerciseitsrulemakingpowers |
|---|
| 1889 | + | 665 pursuanttothecriteriasetforthinthisSectionandtherules |
|---|
| 1890 | + | 666 adoptedthereunder. Rulesandamendmentsshallbecomebindingas |
|---|
| 1891 | + | 667 ofthedatespecifiedineachruleoramendment. |
|---|
| 1892 | + | 668 B.Ifamajorityofthelegislaturesofthememberstates |
|---|
| 1893 | + | 70 669 rejectsarule,byenactmentofastatuteorresolutioninthesame |
|---|
| 1894 | + | 670 mannerusedtoadopttheCompactwithin4yearsofthedateof |
|---|
| 1895 | + | 671 adoptionoftherule,theruleshallhavenofurtherforceand |
|---|
| 1896 | + | 672 effectinanymemberstate. |
|---|
| 1897 | + | 673 C.Rulesoramendmentstotherulesshallbeadoptedata |
|---|
| 1898 | + | 674 regularorspecialmeetingoftheCommission. |
|---|
| 1899 | + | 675 D.Priortopromulgationandadoptionofafinalruleor |
|---|
| 1900 | + | 676 rulesbytheCommission,andatleastthirty(30)daysinadvance |
|---|
| 1901 | + | 677 ofthemeetingatwhichtheruleshallbeconsideredandvoted |
|---|
| 1902 | + | 678 upon,theCommissionshallfileaNoticeofProposedRulemaking: |
|---|
| 1903 | + | 679 1.OnthewebsiteoftheCommissionorotherpublicly |
|---|
| 1904 | + | 680 accessibleplatform;and |
|---|
| 1905 | + | 681 2.Onthewebsiteofeachmemberstateaudiologyorspeech- |
|---|
| 1906 | + | 682 languagepathologylicensingboardorotherpubliclyaccessible |
|---|
| 1907 | + | 683 platformorthepublicationinwhicheachstatewouldotherwise |
|---|
| 1908 | + | 684 publishproposedrules. |
|---|
| 1909 | + | 685 E.TheNoticeofProposedRulemakingshallinclude: |
|---|
| 1910 | + | 686 1.Theproposedtime,date,andlocationofthemeetingin |
|---|
| 1911 | + | 687 whichtheruleshallbeconsideredandvotedupon; |
|---|
| 1912 | + | 688 2.Thetextoftheproposedruleoramendmentandthereason |
|---|
| 1913 | + | 689 fortheproposedrule; |
|---|
| 1914 | + | 690 3.Arequestforcommentsontheproposedrulefromany |
|---|
| 1915 | + | 691 interestedperson;and |
|---|
| 1916 | + | 692 4.Themannerinwhichinterestedpersonsmaysubmitnotice |
|---|
| 1917 | + | 693 totheCommissionoftheirintentiontoattendthepublichearing |
|---|
| 1918 | + | 694 andanywrittencomments. |
|---|
| 1919 | + | 695 F.Priortotheadoptionofaproposedrule,theCommission |
|---|
| 1920 | + | 71 696 shallallowpersonstosubmitwrittendata,facts,opinionsand |
|---|
| 1921 | + | 697 arguments,whichshallbemadeavailabletothepublic. |
|---|
| 1922 | + | 698 G.TheCommissionshallgrantanopportunityforapublic |
|---|
| 1923 | + | 699 hearingbeforeitadoptsaruleoramendmentifahearingis |
|---|
| 1924 | + | 700 requestedby: |
|---|
| 1925 | + | 701 1.Atleasttwenty-five(25)persons; |
|---|
| 1926 | + | 702 2.Astateorfederalgovernmentalsubdivisionoragency;or |
|---|
| 1927 | + | 703 3.Anassociationhavingatleasttwenty-five(25)members. |
|---|
| 1928 | + | 704 H.Ifahearingisheldontheproposedruleoramendment, |
|---|
| 1929 | + | 705 theCommissionshallpublishtheplace,time,anddateofthe |
|---|
| 1930 | + | 706 scheduledpublichearing.Ifthehearingisheldviaelectronic |
|---|
| 1931 | + | 707 means,theCommissionshallpublishthemechanismforaccesstothe |
|---|
| 1932 | + | 708 electronichearing. |
|---|
| 1933 | + | 709 1.Allpersonswishingtobeheardatthehearingshall |
|---|
| 1934 | + | 710 notifytheexecutivedirectoroftheCommissionorother |
|---|
| 1935 | + | 711 designatedmemberinwritingoftheirdesiretoappearandtestify |
|---|
| 1936 | + | 712 atthehearingnotlessthanfive(5)businessdaysbeforethe |
|---|
| 1937 | + | 713 scheduleddateofthehearing. |
|---|
| 1938 | + | 714 2.Hearingsshallbeconductedinamannerprovidingeach |
|---|
| 1939 | + | 715 personwhowishestocommentafairandreasonableopportunityto |
|---|
| 1940 | + | 716 commentorallyorinwriting. |
|---|
| 1941 | + | 717 3.Allhearingsshallberecorded. Acopyoftherecording |
|---|
| 1942 | + | 718 shallbemadeavailableonrequest. |
|---|
| 1943 | + | 719 4.Nothinginthissectionshallbeconstruedasrequiringa |
|---|
| 1944 | + | 720 separatehearingoneachrule.Rulesmaybegroupedforthe |
|---|
| 1945 | + | 721 convenienceoftheCommissionathearingsrequiredbythis |
|---|
| 1946 | + | 722 section. |
|---|
| 1947 | + | 72 723 I.Followingthescheduledhearingdate,orbythecloseof |
|---|
| 1948 | + | 724 businessonthescheduledhearingdateifthehearingwasnotheld, |
|---|
| 1949 | + | 725 theCommissionshallconsiderallwrittenandoralcomments |
|---|
| 1950 | + | 726 received. |
|---|
| 1951 | + | 727 J.Ifnowrittennoticeofintenttoattendthepublic |
|---|
| 1952 | + | 728 hearingbyinterestedpartiesisreceived,theCommissionmay |
|---|
| 1953 | + | 729 proceedwithpromulgationoftheproposedrulewithoutapublic |
|---|
| 1954 | + | 730 hearing. |
|---|
| 1955 | + | 731 K.TheCommissionshall,bymajorityvoteofallmembers, |
|---|
| 1956 | + | 732 takefinalactionontheproposedruleandshalldeterminethe |
|---|
| 1957 | + | 733 effectivedateoftherule,ifany,basedontherulemakingrecord |
|---|
| 1958 | + | 734 andthefulltextoftherule. |
|---|
| 1959 | + | 735 L.Upondeterminationthatanemergencyexists,the |
|---|
| 1960 | + | 736 Commissionmayconsiderandadoptanemergencyrulewithoutprior |
|---|
| 1961 | + | 737 notice,opportunityforcomment,orhearing,providedthatthe |
|---|
| 1962 | + | 738 usualrulemakingproceduresprovidedintheCompactandinthis |
|---|
| 1963 | + | 739 sectionshallberetroactivelyappliedtotheruleassoonas |
|---|
| 1964 | + | 740 reasonablypossible,innoeventlaterthanninety(90)daysafter |
|---|
| 1965 | + | 741 theeffectivedateoftherule.Forthepurposesofthis |
|---|
| 1966 | + | 742 provision,anemergencyruleisonethatmustbeadopted |
|---|
| 1967 | + | 743 immediatelyinorderto: |
|---|
| 1968 | + | 744 1.Meetanimminentthreattopublichealth,safety,or |
|---|
| 1969 | + | 745 welfare; |
|---|
| 1970 | + | 746 2.PreventalossofCommissionormemberstatefunds;or |
|---|
| 1971 | + | 747 3.Meetadeadlineforthepromulgationofanadministrative |
|---|
| 1972 | + | 748 rulethatisestablishedbyfederallaworrule. |
|---|
| 1973 | + | 749 M.TheCommissionoranauthorizedcommitteeofthe |
|---|
| 1974 | + | 73 750 Commissionmaydirectrevisionstoapreviouslyadoptedruleor |
|---|
| 1975 | + | 751 amendmentforpurposesofcorrectingtypographicalerrors,errors |
|---|
| 1976 | + | 752 informat,errorsinconsistency,orgrammaticalerrors.Public |
|---|
| 1977 | + | 753 noticeofanyrevisionsshallbepostedonthewebsiteofthe |
|---|
| 1978 | + | 754 Commission. Therevisionshallbesubjecttochallengebyany |
|---|
| 1979 | + | 755 personforaperiodofthirty(30)daysafterposting.The |
|---|
| 1980 | + | 756 revisionmaybechallengedonlyongroundsthattherevision |
|---|
| 1981 | + | 757 resultsinamaterialchangetoarule.Achallengeshallbemade |
|---|
| 1982 | + | 758 inwritinganddeliveredtothechairoftheCommissionpriorto |
|---|
| 1983 | + | 759 theendofthenoticeperiod.Ifnochallengeismade,the |
|---|
| 1984 | + | 760 revisionshalltakeeffectwithoutfurtheraction.Iftherevision |
|---|
| 1985 | + | 761 ischallenged,therevisionmaynottakeeffectwithoutthe |
|---|
| 1986 | + | 762 approvaloftheCommission. |
|---|
| 1987 | + | 763 SECTION11.OVERSIGHT,DISPUTERESOLUTION,ANDENFORCEMENT |
|---|
| 1988 | + | 764 A.DisputeResolution |
|---|
| 1989 | + | 765 1.Uponrequestbyamemberstate,theCommissionshall |
|---|
| 1990 | + | 766 attempttoresolvedisputesrelatedtotheCompactthatariseamong |
|---|
| 1991 | + | 767 memberstatesandbetweenmemberandnon-memberstates. |
|---|
| 1992 | + | 768 2.TheCommissionshallpromulgatearuleprovidingforboth |
|---|
| 1993 | + | 769 mediationandbindingdisputeresolutionfordisputesas |
|---|
| 1994 | + | 770 appropriate. |
|---|
| 1995 | + | 771 B.Enforcement |
|---|
| 1996 | + | 772 1.TheCommission,inthereasonableexerciseofits |
|---|
| 1997 | + | 773 discretion,shallenforcetheprovisionsandrulesofthis |
|---|
| 1998 | + | 774 Compact. |
|---|
| 1999 | + | 775 2.Bymajorityvote,theCommissionmayinitiatelegalaction |
|---|
| 2000 | + | 776 intheUnitedStatesDistrictCourtfortheDistrictofColumbiaor |
|---|
| 2001 | + | 74 777 thefederaldistrictwheretheCommissionhasitsprincipal |
|---|
| 2002 | + | 778 officesagainstamemberstateindefaulttoenforcecompliance |
|---|
| 2003 | + | 779 withtheprovisionsoftheCompactanditspromulgatedrulesand |
|---|
| 2004 | + | 780 bylaws.Thereliefsoughtmayincludebothinjunctivereliefand |
|---|
| 2005 | + | 781 damages.Intheeventjudicialenforcementisnecessary,the |
|---|
| 2006 | + | 782 prevailingmembershallbeawardedallcostsoflitigation, |
|---|
| 2007 | + | 783 includingreasonableattorney'sfees. |
|---|
| 2008 | + | 784 3.Theremedieshereinshallnotbetheexclusiveremediesof |
|---|
| 2009 | + | 785 theCommission. TheCommissionmaypursueanyotherremedies |
|---|
| 2010 | + | 786 availableunderfederalorstatelaw. |
|---|
| 2011 | + | 787 SECTION12.DATEOFIMPLEMENTATIONOFTHEINTERSTATE |
|---|
| 2012 | + | 788 COMMISSIONFORAUDIOLOGYANDSPEECH-LANGUAGE PATHOLOGYPRACTICE |
|---|
| 2013 | + | 789 ANDASSOCIATEDRULES,WITHDRAWAL,ANDAMENDMENT |
|---|
| 2014 | + | 790 A.TheCompactshallcomeintoeffectonthedateonwhich |
|---|
| 2015 | + | 791 theCompactstatuteisenactedintolawinthe10thmemberstate. |
|---|
| 2016 | + | 792 Theprovisions,whichbecomeeffectiveatthattime,shallbe |
|---|
| 2017 | + | 793 limitedtothepowersgrantedtotheCommissionrelatingto |
|---|
| 2018 | + | 794 assemblyandthepromulgationofrules.Thereafter,the |
|---|
| 2019 | + | 795 Commissionshallmeetandexerciserulemakingpowersnecessaryto |
|---|
| 2020 | + | 796 theimplementationandadministrationoftheCompact. |
|---|
| 2021 | + | 797 B.AnystatethatjoinstheCompactsubsequenttothe |
|---|
| 2022 | + | 798 Commission'sinitialadoptionoftherulesshallbesubjecttothe |
|---|
| 2023 | + | 799 rulesastheyexistonthedateonwhichtheCompactbecomeslawin |
|---|
| 2024 | + | 800 thatstate.Anyrulethathasbeenpreviouslyadoptedbythe |
|---|
| 2025 | + | 801 Commissionshallhavethefullforceandeffectoflawontheday |
|---|
| 2026 | + | 802 theCompactbecomeslawinthatstate. |
|---|
| 2027 | + | 803 C.AnymemberstatemaywithdrawfromthisCompactby |
|---|
| 2028 | + | 75 804 enactingastatuterepealingthesame. |
|---|
| 2029 | + | 805 1.Amemberstate'swithdrawalshallnottakeeffectuntil |
|---|
| 2030 | + | 806 six(6)monthsafterenactmentoftherepealingstatute. |
|---|
| 2031 | + | 807 2.Withdrawalshallnotaffectthecontinuingrequirementof |
|---|
| 2032 | + | 808 thewithdrawingstate'saudiologyorspeech-language pathology |
|---|
| 2033 | + | 809 licensingboardtocomplywiththeinvestigativeandadverse |
|---|
| 2034 | + | 810 actionreportingrequirementsofthisactpriortotheeffective |
|---|
| 2035 | + | 811 dateofwithdrawal. |
|---|
| 2036 | + | 812 D.NothingcontainedinthisCompactshallbeconstruedto |
|---|
| 2037 | + | 813 invalidateorpreventanyaudiologyorspeech-language pathology |
|---|
| 2038 | + | 814 licensureagreementorothercooperativearrangementbetweena |
|---|
| 2039 | + | 815 memberstateandanon-memberstatethatdoesnotconflictwiththe |
|---|
| 2040 | + | 816 provisionsofthisCompact. |
|---|
| 2041 | + | 817 E.ThisCompactmaybeamendedbythememberstates.No |
|---|
| 2042 | + | 818 amendmenttothisCompactshallbecomeeffectiveandbindingupon |
|---|
| 2043 | + | 819 anymemberstateuntilitisenactedintothelawsofallmember |
|---|
| 2044 | + | 820 states. |
|---|
| 2045 | + | 821 SECTION13.CONSTRUCTIONANDSEVERABILITY |
|---|
| 2046 | + | 822 ThisCompactshallbeliberallyconstruedsoastoeffectuate |
|---|
| 2047 | + | 823 thepurposesthereof.TheprovisionsofthisCompactshallbe |
|---|
| 2048 | + | 824 severableandifanyphrase,clause,sentenceorprovisionofthis |
|---|
| 2049 | + | 825 Compactisdeclaredtobecontrarytotheconstitutionofany |
|---|
| 2050 | + | 826 memberstateoroftheUnitedStatesortheapplicabilitythereof |
|---|
| 2051 | + | 827 toanygovernment,agency,personorcircumstanceisheldinvalid, |
|---|
| 2052 | + | 828 thevalidityoftheremainderofthisCompactandtheapplicability |
|---|
| 2053 | + | 829 thereoftoanygovernment,agency,personorcircumstanceshall |
|---|
| 2054 | + | 830 notbeaffectedthereby.IfthisCompactshallbeheldcontraryto |
|---|
| 2055 | + | 76 831 theconstitutionofanymemberstate,theCompactshallremainin |
|---|
| 2056 | + | 832 fullforceandeffectastotheremainingmemberstatesandinfull |
|---|
| 2057 | + | 833 forceandeffectastothememberstateaffectedastoall |
|---|
| 2058 | + | 834 severablematters. |
|---|
| 2059 | + | 835 SECTION14.BINDINGEFFECTOFCOMPACTANDOTHERLAWS |
|---|
| 2060 | + | 836 A.Nothinghereinpreventstheenforcementofanyotherlaw |
|---|
| 2061 | + | 837 ofamemberstatethatisnotinconsistentwiththeCompact. |
|---|
| 2062 | + | 838 B.AlllawsinamemberstateinconflictwiththeCompact |
|---|
| 2063 | + | 839 aresupersededtotheextentoftheconflict. |
|---|
| 2064 | + | 840 C.AlllawfulactionsoftheCommission,includingallrules |
|---|
| 2065 | + | 841 andbylawspromulgatedbytheCommission,arebindinguponthe |
|---|
| 2066 | + | 842 memberstates. |
|---|
| 2067 | + | 843 D.AllagreementsbetweentheCommissionandthemember |
|---|
| 2068 | + | 844 statesarebindinginaccordancewiththeirterms. |
|---|
| 2069 | + | 845 E.IntheeventanyprovisionoftheCompactexceedsthe |
|---|
| 2070 | + | 846 constitutionallimitsimposedonthelegislatureofanymember |
|---|
| 2071 | + | 847 state,theprovisionshallbeineffectivetotheextentofthe |
|---|
| 2072 | + | 848 conflictwiththeconstitutionalprovisioninquestioninthat |
|---|
| 2073 | + | 849 memberstate. |
|---|
| 2074 | + | SectionB.Becauseoftheurgentneedoflow-incomeMissouri |
|---|
| 2075 | + | 2 residentsforaccesstoqualityhealthcareservices,the |
|---|
| 2076 | + | 3 enactmentofsection324.005ofthisactisdeemednecessaryfor |
|---|
| 2077 | + | 4 theimmediatepreservationofthepublichealth,welfare,peace, |
|---|
| 2078 | + | 5 andsafety,andisherebydeclaredtobeanemergencyactwithin |
|---|
| 2079 | + | 6 themeaningoftheconstitution,andtheenactmentofsection |
|---|
| 2080 | + | 7 324.005ofthisactshallbeinfullforceandeffectuponits |
|---|
| 2081 | + | 8 passageandapproval. |
|---|
| 2082 | + | 77 ✓ |
|---|
| 2083 | + | HouseSponsor SenateHandler |
|---|
| 2084 | + | 78 |
|---|