| 21 | | - | SectionA.Sections43.503,43.505,56.265,56.265,56.750,57.010,82.1000,84.020, |
|---|
| 22 | | - | 284.030,84.100,84.150,84.160,84.170,84.175,84.240,84.341,84.342,84.343,84.344, |
|---|
| 23 | | - | 384.345,84.346,84.347,105.726,217.825,217.827,217.829,217.831,217.833,217.835, |
|---|
| 24 | | - | 4217.837,217.839,217.841,304.012,455.095,513.605,556.061,566.210,566.211,568.045, |
|---|
| 25 | | - | 5570.030,574.050,575.133,575.150,576.030,577.150,590.040,595.209,and650.058, |
|---|
| 26 | | - | 6RSMo,andsection56.265asenactedbysenatebillno.672,ninety-seventhgeneralassembly, |
|---|
| 27 | | - | 7secondregularsession,andsection56.265asenactedbysenatebillno.275,ninetiethgeneral |
|---|
| 28 | | - | 8assembly,firstregularsession,arerepealedandforty-twonewsectionsenactedinlieu |
|---|
| 29 | | - | EXPLANATION—Matterenclosedinbold-facedbrackets[thus] intheabovebillisnotenactedandis |
|---|
| 30 | | - | intendedtobeomittedfromthelaw.Matterinbold-facetypeintheabovebillisproposedlanguage. 9thereof,tobeknownassections43.503,43.505,44.087,56.265,56.750,57.010,82.1000, |
|---|
| 31 | | - | 1084.012,84.020,84.030,84.100,84.150,84.160,84.170,84.225,84.325,105.726,191.1005, |
|---|
| 32 | | - | 11217.451,221.108,221.520,221.523,304.012,304.145,455.095,491.065,513.605,556.061, |
|---|
| 33 | | - | 12566.210,566.211,568.045,570.030,575.133,575.150,576.030,577.150,590.040,590.208, |
|---|
| 34 | | - | 13595.209,595.325,650.058,and1,toreadasfollows: |
|---|
| 35 | | - | 43.503.1.Forthepurposeofmaintainingcompleteandaccuratecriminalhistory |
|---|
| 36 | | - | 2recordinformation,allpoliceofficersofthisstate,theclerkofeachcourt,thedepartmentof |
|---|
| 37 | | - | 3corrections,thesheriffofeachcounty,thechieflawenforcementofficialofacitynotwithina |
|---|
| 38 | | - | 4countyandtheprosecutingattorneyofeachcountyorthecircuitattorneyofacitynotwithin |
|---|
| 39 | | - | 5acountyshallsubmitcertaincriminalarrest,charge,anddispositioninformationtothe |
|---|
| 40 | | - | 6centralrepositoryforfilingwithoutunduedelayintheformandmannerrequiredbysections |
|---|
| 41 | | - | 743.500to43.651. |
|---|
| 42 | | - | 8 2.Alllawenforcementagenciesmakingmisdemeanorandfelonyarrestsas |
|---|
| 43 | | - | 9determinedbysection43.506shallfurnishwithoutunduedelay,tothecentralrepository, |
|---|
| 44 | | - | 10fingerprints,photograph,andifavailable,anyotheruniquebiometricidentificationcollected, |
|---|
| 45 | | - | 11charges,appropriatechargecodes,anddescriptionsofallpersonswhoarearrestedforsuch |
|---|
| 46 | | - | 12offensesonstandardfingerprintformssuppliedorapprovedbythehighwaypatrolor |
|---|
| 47 | | - | 13electronicallyinaformatandmannerapprovedbythehighwaypatrolandincompliancewith |
|---|
| 48 | | - | 14thestandardssetbytheFederalBureauofInvestigationinitsAutomatedFingerprint |
|---|
| 49 | | - | 15IdentificationSystemoritssuccessorprogram.Allsuchagenciesshallalsonotifythecentral |
|---|
| 50 | | - | 16repositoryofalldecisionsnottorefersucharrestsforprosecution.Anagencymakingsuch |
|---|
| 51 | | - | 17arrestsmayenterintoarrangementswithotherlawenforcementagenciesforthepurposeof |
|---|
| 52 | | - | 18furnishingwithoutunduedelaysuchfingerprints,photograph,andifavailable,anyother |
|---|
| 53 | | - | 19uniquebiometricidentificationcollected,charges,appropriatechargecodes,anddescriptions |
|---|
| 54 | | - | 20tothecentralrepositoryuponitsbehalf. |
|---|
| 55 | | - | 21 3.InorderfortheMissouriofficeofprosecutionservicestomaintaincomplete |
|---|
| 56 | | - | 22andaccuratestatewidereportsasrequiredbysection56.750,onorbeforeJanuary1, |
|---|
| 57 | | - | 232028,andthereafter,allpoliceofficersofthisstate,thesheriffandeachdeputysheriffof |
|---|
| 58 | | - | 24eachcounty,andthechieflawenforcementofficialofacitynotwithinacountyandhis |
|---|
| 59 | | - | 25orherofficersshallsubmitreferralsforanytrafficviolation,ordinanceviolation,or |
|---|
| 60 | | - | 26misdemeanororfelonyoffensereferredtoaprosecutingorcircuitattorneyintheform |
|---|
| 61 | | - | 27andmannerapprovedbytheMissouriofficeofprosecutionservicesasrequiredby |
|---|
| 62 | | - | 28subdivision(7)ofsubsection1ofsection56.750.Ataminimum,anyreferraltoa |
|---|
| 63 | | - | 29prosecutingattorneyorcircuitattorneyforafelonyoffenseshallincludeaprobable |
|---|
| 64 | | - | 30causestatementandaninvestigativereport.Anylawenforcementagencythatviolates |
|---|
| 65 | | - | 31thissubsectionshallbeineligibletoreceivestateorfederalfundsthatwouldotherwise |
|---|
| 66 | | - | 32bepaidtosuchagencyforlawenforcement,safety,orcriminaljusticepurposes. |
|---|
| 67 | | - | SS#2SCSHCS#2HB495 2 33 4.Ininstanceswhereanindividuallessthanseventeenyearsofageandnotcurrently |
|---|
| 68 | | - | 34certifiedasanadultistakenintocustodyforanoffensewhichwouldbeafelonyifcommitted |
|---|
| 69 | | - | 35byanadult,thearrestingofficershalltakefingerprintsforthecentralrepository.These |
|---|
| 70 | | - | 36fingerprintsshallbetakenonfingerprintcardssuppliedbyorapprovedbythehighwaypatrol |
|---|
| 71 | | - | 37ortransmittedelectronicallyinaformatandmannerapprovedbythehighwaypatrolandin |
|---|
| 72 | | - | 38compliancewiththestandardssetbytheFederalBureauofInvestigationinitsAutomated |
|---|
| 73 | | - | 39FingerprintIdentificationSystemoritssuccessorprogram.Thefingerprintcardsshallbeso |
|---|
| 74 | | - | 40constructedthatthenameofthejuvenileshouldnotbemadeavailabletothecentral |
|---|
| 75 | | - | 41repository.Theindividual'snameandtheuniquenumberassociatedwiththefingerprintsand |
|---|
| 76 | | - | 42otherpertinentinformationshallbeprovidedtothecourtofjurisdictionbytheagencytaking |
|---|
| 77 | | - | 43thejuvenileintocustody.Thejuvenile'sfingerprintsandotherinformationshallbe |
|---|
| 78 | | - | 44forwardedtothecentralrepositoryandthecourtswithoutunduedelay.Thefingerprint |
|---|
| 79 | | - | 45informationfromthecardshallbecapturedandstoredintheautomatedfingerprint |
|---|
| 80 | | - | 46identificationsystemoperatedbythecentralrepository.Intheeventthefingerprintsare |
|---|
| 81 | | - | 47foundtomatchothertenprintsorunsolvedlatentprints,thecentralrepositoryshallnotifythe |
|---|
| 82 | | - | 48submittingagencywhoshallnotifythecourtofjurisdictionasperlocalagreement.Under |
|---|
| 83 | | - | 49section211.031,ininstanceswhereajuvenileoverfifteenandone-halfyearsofageisalleged |
|---|
| 84 | | - | 50tohaveviolatedastateormunicipaltrafficordinanceorregulation,whichdoesnotconstitute |
|---|
| 85 | | - | 51afelony,andthejuvenilecourtdoesnothavejurisdiction,thejuvenileshallnotbe |
|---|
| 86 | | - | 52fingerprintedunlesscertifiedasanadult. |
|---|
| 87 | | - | 53 [4.]5.Uponcertificationoftheindividualasanadult,thecertifyingcourtshallorder |
|---|
| 88 | | - | 54alawenforcementagencytoimmediatelyfingerprintandphotographtheindividualand |
|---|
| 89 | | - | 55certificationpaperswillbeforwardedtotheappropriatelawenforcementagencywiththe |
|---|
| 90 | | - | 56orderforfingerprinting.Thelawenforcementagencyshallsubmitsuchfingerprints, |
|---|
| 91 | | - | 57photograph,andcertificationpaperstothecentralrepositorywithinfifteendaysandshall |
|---|
| 92 | | - | 58furnishtheoffensecyclenumberassociatedwiththefingerprintstotheprosecutingattorney |
|---|
| 93 | | - | 59orthecircuitattorneyofacitynotwithinacountyandtotheclerkofthecourtorderingthe |
|---|
| 94 | | - | 60subjectfingerprinted.Ifthejuvenileisacquittedofthecrimeandisnolongercertifiedasan |
|---|
| 95 | | - | 61adult,theprosecutingattorneyshallnotifywithinfifteendaysthecentralrepositoryofthe |
|---|
| 96 | | - | 62changeofstatusofthejuvenile.Recordsofachildwhohasbeenfingerprintedand |
|---|
| 97 | | - | 63photographedafterbeingtakenintocustodyshallbeclosedrecordsasprovidedundersection |
|---|
| 98 | | - | 64610.100ifapetitionhasnotbeenfiledwithinthirtydaysofthedatethatthechildwastaken |
|---|
| 99 | | - | 65intocustody;andifapetitionforthechildhasnotbeenfiledwithinoneyearofthedatethe |
|---|
| 100 | | - | 66childwastakenintocustody,anyrecordsrelatingtothechildconcerningtheallegedoffense |
|---|
| 101 | | - | 67maybeexpungedundertheproceduresinsections610.122to610.126. |
|---|
| 102 | | - | 68 [5.]6.Theprosecutingattorneyofeachcountyorthecircuitattorneyofacitynot |
|---|
| 103 | | - | 69withinacountyorthemunicipalprosecutingattorneyshallnotifythecentralrepositoryon |
|---|
| 104 | | - | SS#2SCSHCS#2HB495 3 70standardformssuppliedbythehighwaypatrolorinamannerapprovedbythehighwaypatrol |
|---|
| 105 | | - | 71ofhisorherdecisiontonotfileacriminalchargeonanychargereferredtosuchprosecuting |
|---|
| 106 | | - | 72attorneyorcircuitattorneyforcriminalcharges.Allrecordsforwardedtothecentral |
|---|
| 107 | | - | 73repositoryandthecourtsbyprosecutorsorcircuitattorneysasrequiredbysections43.500to |
|---|
| 108 | | - | 7443.530shallincludethestateoffensecyclenumberoftheoffense,thechargecodeforthe |
|---|
| 109 | | - | 75offense,andtheoriginatingagencyidentifiernumberofthereportingprosecutor,usingsuch |
|---|
| 110 | | - | 76numbersasassignedbythehighwaypatrol. |
|---|
| 111 | | - | 77 [6.]7.Theclerkofthecourtsofeachcountyorcitynotwithinacountyormunicipal |
|---|
| 112 | | - | 78courtclerkshallfurnishthecentralrepository,onstandardformssuppliedbythehighway |
|---|
| 113 | | - | 79patrolorinamannerapprovedbythehighwaypatrol,witharecordofallchargesfiled, |
|---|
| 114 | | - | 80includingallthoseaddedsubsequenttothefilingofacriminalcourtcase,amendedcharges, |
|---|
| 115 | | - | 81andallfinaldispositionsofcasesforwhichthecentralrepositoryhasarecordofanarrestora |
|---|
| 116 | | - | 82recordoffingerprintsreportedpursuanttosections43.500to43.506.Suchinformationshall |
|---|
| 117 | | - | 83include,foreachcharge: |
|---|
| 118 | | - | 84 (1)Alljudgmentsofnotguilty,acquittalsonthegroundofmentaldiseaseordefect |
|---|
| 119 | | - | 85excludingresponsibility,judgmentsorpleasofguiltyincludingthesentence,ifany,or |
|---|
| 120 | | - | 86probation,ifany,pronouncedbythecourt,nollepros,discharges,releasesanddismissalsin |
|---|
| 121 | | - | 87thetrialcourt; |
|---|
| 122 | | - | 88 (2)Courtordersfiledwiththeclerkofthecourtswhichreverseareportedconviction |
|---|
| 123 | | - | 89orvacateormodifyasentence; |
|---|
| 124 | | - | 90 (3)Judgmentsterminatingorrevokingasentencetoprobation,supervisionor |
|---|
| 125 | | - | 91conditionalreleaseandanyresentencingaftersuchrevocation;and |
|---|
| 126 | | - | 92 (4)Theoffensecyclenumberoftheoffense,andtheoriginatingagencyidentifier |
|---|
| 127 | | - | 93numberofthesentencingcourt,usingsuchnumbersasassignedbythehighwaypatrol. |
|---|
| 128 | | - | 94 [7.]8.Theclerkofthecourtsofeachcountyorcitynotwithinacountyshallfurnish, |
|---|
| 129 | | - | 95tothedepartmentofcorrectionsordepartmentofmentalhealth,courtjudgmentandsentence |
|---|
| 130 | | - | 96documentsandthestateoffensecyclenumberandthechargecodeoftheoffensewhich |
|---|
| 131 | | - | 97resultedinthecommitmentorassignmentofanoffendertothejurisdictionofthedepartment |
|---|
| 132 | | - | 98ofcorrectionsorthedepartmentofmentalhealthifthepersoniscommittedpursuantto |
|---|
| 133 | | - | 99chapter552.Thisinformationshallbereportedtothedepartmentofcorrectionsorthe |
|---|
| 134 | | - | 100departmentofmentalhealthatthetimeofcommitmentorassignment.Iftheoffenderwas |
|---|
| 135 | | - | 101alreadyinthecustodyofthedepartmentofcorrectionsorthedepartmentofmentalhealthat |
|---|
| 136 | | - | 102thetimeofsuchsubsequentconviction,theclerkshallfurnishnoticeofsuchsubsequent |
|---|
| 137 | | - | 103convictiontotheappropriatedepartmentbycertifiedmail,returnreceiptrequested,orina |
|---|
| 138 | | - | 104mannerandformatmutuallyagreedto,withinfifteendaysofsuchdisposition. |
|---|
| 139 | | - | 105 [8.]9.Informationandfingerprints,photographandifavailable,anyotherunique |
|---|
| 140 | | - | 106biometricidentificationcollected,forwardedtothecentralrepository,normallyobtainedfrom |
|---|
| 141 | | - | SS#2SCSHCS#2HB495 4 107apersonatthetimeofthearrest,maybeobtainedatanytimethesubjectisinthecriminal |
|---|
| 142 | | - | 108justicesystemorcommittedtothedepartmentofmentalhealth.Alawenforcementagency |
|---|
| 143 | | - | 109orthedepartmentofcorrectionsmayfingerprint,photograph,andcaptureanyotherunique |
|---|
| 144 | | - | 110biometricidentificationofthepersonunlesscollectingotheruniquebiometricidentification |
|---|
| 145 | | - | 111ofthepersonisnotfinanciallyfeasibleforthelawenforcementagency,andobtainthe |
|---|
| 146 | | - | 112necessaryinformationatanytimethesubjectisincustody.Ifatthetimeofanycourt |
|---|
| 147 | | - | 113appearance,thedefendanthasnotbeenfingerprintedandphotographedforanoffensein |
|---|
| 148 | | - | 114whichafingerprintandphotographisrequiredbystatutetobecollected,maintained,or |
|---|
| 149 | | - | 115disseminatedbythecentralrepository,thecourtshallorderalawenforcementagencyor |
|---|
| 150 | | - | 116courtmarshaltofingerprintandphotographimmediatelythedefendant.Theorderfor |
|---|
| 151 | | - | 117fingerprintsshallcontaintheoffense,chargecode,dateofoffense,andanyotherinformation |
|---|
| 152 | | - | 118necessarytocompletethefingerprintcard.Thelawenforcementagencyorcourtmarshal |
|---|
| 153 | | - | 119shallsubmitsuchfingerprints,photograph,andifavailable,anyotheruniquebiometric |
|---|
| 154 | | - | 120identificationcollected,tothecentralrepositorywithoutunduedelayandwithinthirtydays |
|---|
| 155 | | - | 121andshallfurnishtheoffensecyclenumberassociatedwiththefingerprintstotheprosecuting |
|---|
| 156 | | - | 122attorneyorthecircuitattorneyofacitynotwithinacountyandtothecourtclerkofthecourt |
|---|
| 157 | | - | 123orderingthesubjectfingerprinted. |
|---|
| 158 | | - | 124 [9.]10.Thedepartmentofcorrectionsandthedepartmentofmentalhealthshall |
|---|
| 159 | | - | 125furnishthecentralrepositorywithallinformationconcerningthereceipt,escape,execution, |
|---|
| 160 | | - | 126death,release,pardon,parole,commutationofsentence,grantingofexecutiveclemency, |
|---|
| 161 | | - | 127legalnamechange,ordischargeofanindividualwhohasbeensentencedtothatdepartment's |
|---|
| 162 | | - | 128custodyforanyoffenseswhicharemandatedbylawtobecollected,maintainedor |
|---|
| 163 | | - | 129disseminatedbythecentralrepository.Allrecordsforwardedtothecentralrepositorybythe |
|---|
| 164 | | - | 130departmentasrequiredbysections43.500to43.651shallincludetheoffensecyclenumberof |
|---|
| 165 | | - | 131theoffense,andtheoriginatingagencyidentifiernumberofthedepartmentusingsuch |
|---|
| 166 | | - | 132numbersasassignedbythehighwaypatrol. |
|---|
| 167 | | - | 43.505.1.Thedepartmentofpublicsafetyisherebydesignatedasthecentral |
|---|
| 168 | | - | 2repositoryforthecollection,maintenance,analysisandreportingofcrimeincidentactivity |
|---|
| 169 | | - | 3generatedbylawenforcementagenciesinthisstate.Thedepartmentshalldevelopand |
|---|
| 170 | | - | 4operateauniformcrimereportingsystemthatiscompatiblewiththenationaluniformcrime |
|---|
| 171 | | - | 5reportingsystemoperatedbytheFederalBureauofInvestigation. |
|---|
| 172 | | - | 6 2.Thedepartmentofpublicsafetyshall: |
|---|
| 173 | | - | 7 (1)Develop,operateandmaintainaninformationsystemforthecollection,storage, |
|---|
| 174 | | - | 8maintenance,analysisandretrievalofcrimeincidentandarrestreportsfromMissourilaw |
|---|
| 175 | | - | 9enforcementagencies; |
|---|
| 176 | | - | SS#2SCSHCS#2HB495 5 10 (2)CompilethestatisticaldataandforwardsuchdataasrequiredtotheFederal |
|---|
| 177 | | - | 11BureauofInvestigationortheappropriateDepartmentofJusticeagencyinaccordancewith |
|---|
| 178 | | - | 12thestandardsandproceduresofthenationalsystem; |
|---|
| 179 | | - | 13 (3)Providetheforms,formats,procedures,standardsandrelatedtrainingortraining |
|---|
| 180 | | - | 14assistancetoalllawenforcementagenciesinthestateasnecessaryforsuchagenciestoreport |
|---|
| 181 | | - | 15incidentandarrestactivityfortimelyinclusionintothestatewidesystem; |
|---|
| 182 | | - | 16 (4)Annuallypublishareportonthenatureandextentofcrimeandsubmitsuch |
|---|
| 183 | | - | 17reporttothegovernorandthegeneralassembly.Suchreportandotherstatisticalreportsshall |
|---|
| 184 | | - | 18bemadeavailabletostateandlocallawenforcementagenciesandthegeneralpublicthrough |
|---|
| 185 | | - | 19anelectronicormanualmedium; |
|---|
| 186 | | - | 20 (5)Maintaintheprivacyandsecurityofinformationinaccordancewithapplicable |
|---|
| 187 | | - | 21stateandfederallaws,regulationsandorders;and |
|---|
| 188 | | - | 22 (6)Establishsuchrulesandregulationsasarenecessaryforimplementingthe |
|---|
| 189 | | - | 23provisionsofthissection.Anyruleorportionofarule,asthattermisdefinedinsection |
|---|
| 190 | | - | 24536.010,thatiscreatedundertheauthoritydelegatedinthissectionshallbecomeeffective |
|---|
| 191 | | - | 25onlyifitcomplieswithandissubjecttoalloftheprovisionsofchapter536and,ifapplicable, |
|---|
| 192 | | - | 26section536.028.Thissectionandchapter536arenonseverableandifanyofthepowers |
|---|
| 193 | | - | 27vestedwiththegeneralassemblypursuanttochapter536toreview,todelaytheeffectivedate |
|---|
| 194 | | - | 28ortodisapproveandannularulearesubsequentlyheldunconstitutional,thenthegrantof |
|---|
| 195 | | - | 29rulemakingauthorityandanyruleproposedoradoptedafterAugust28,2000,shallbeinvalid |
|---|
| 196 | | - | 30andvoid. |
|---|
| 197 | | - | 31 3.Everylawenforcementagencyinthestateshall: |
|---|
| 198 | | - | 32 (1)Submitcrimeincidentreportstothedepartmentofpublicsafetyonformsorinthe |
|---|
| 199 | | - | 33formatprescribedbythedepartment;and |
|---|
| 200 | | - | 34 (2)Submitanyothercrimeincidentinformationwhichmayberequiredbythe |
|---|
| 201 | | - | 35departmentofpublicsafety, includinginformationpertainingtothecitizenor |
|---|
| 202 | | - | 36immigrationstatusofanypersonarrestedforanoffensethatisreportableunder |
|---|
| 203 | | - | 37section43.506. |
|---|
| 204 | | - | 38 4.AnylawenforcementagencythatviolatesthissectionafterDecember31,2021, |
|---|
| 205 | | - | 39maybeineligibletoreceivestateorfederalfundswhichwouldotherwisebepaidtosuch |
|---|
| 206 | | - | 40agencyforlawenforcement,safetyorcriminaljusticepurposes. |
|---|
| 207 | | - | 44.087.1.Thechieflawenforcementexecutiveforanylawenforcementagency, |
|---|
| 208 | | - | 2orsuchexecutive'sdesignee,mayrequestassistancefromalawenforcementagencyof |
|---|
| 209 | | - | 3anotherjurisdiction,includingajurisdictionoutsidethestateofMissouributwithinthe |
|---|
| 210 | | - | 4UnitedStates. |
|---|
| 211 | | - | 5 2.Ifalawenforcementofficermakesanarrestorapprehensionoutsidesuch |
|---|
| 212 | | - | 6officer'sjurisdiction,theoffendershallbedeliveredtothefirstavailablelaw |
|---|
| 213 | | - | SS#2SCSHCS#2HB495 6 7enforcementofficerwhoiscommissionedinthejurisdictioninwhichthearrestwas |
|---|
| 214 | | - | 8made.Theofficermakingtheinitialarrestorapprehensionshallassistinthe |
|---|
| 215 | | - | 9preparationofanyaffidavitsfiledwiththecomplaintorbasedonotherevidencethat |
|---|
| 216 | | - | 10thereisprobablecausetobelievethatbothacrimehasbeencommittedandthe |
|---|
| 217 | | - | 11defendanthascommittedsuchcrime. |
|---|
| 218 | | - | 12 3.Forthepurposeofliability,workers'compensation,andanyother |
|---|
| 219 | | - | 13employment-relatedmatter,lawenforcementofficersremainemployeesoftheir |
|---|
| 220 | | - | 14respectivelawenforcementagencythroughoutanyrequestforassistance.Qualified |
|---|
| 221 | | - | 15immunity,sovereignimmunity,officialimmunity,andthepublicdutyruleshallapplyto |
|---|
| 222 | | - | 16theprovisionsofthissectionasinterpretedbythefederalandstatecourtsofthe |
|---|
| 223 | | - | 17respondingagency. |
|---|
| 224 | | - | 18 4.Nothinginthissectionshallbeconstruedtolimittheactionsoflaw |
|---|
| 225 | | - | 19enforcementofficersoragenciesconductedinaccordancewithsection44.095or44.098, |
|---|
| 226 | | - | 20oranyothermutualaidagreementmadeunderthischapter. |
|---|
| 227 | | - | 21 5.Theprovisionsofchapter544areapplicabletoanylawenforcementofficers |
|---|
| 228 | | - | 22fromjurisdictionslocatedoutsidethestateofMissouri,butwithintheUnitedStates, |
|---|
| 229 | | - | 23whoareactingpursuanttoarequestmadeunderthissection. |
|---|
| 230 | | - | [56.265.1.Thecountyprosecutingattorneyinanycounty,otherthan |
|---|
| 231 | | - | 2 inacharteredcounty,shallreceiveanannualsalarycomputedusingthe |
|---|
| 232 | | - | 3 followingschedule,whenapplicable.Theassessedvaluationfactorshallbe |
|---|
| 233 | | - | 4 theamountthereofasshownfortheyearimmediatelyprecedingtheyearfor |
|---|
| 234 | | - | 5 whichthecomputationisdone. |
|---|
| 235 | | - | 6 (1)Forafull-timeprosecutortheprosecutorshallreceive |
|---|
| 236 | | - | 7 compensationequaltothecompensationofanassociatecircuitjudge; |
|---|
| 237 | | - | 8 (2)Forapart-timeprosecutor: |
|---|
| 238 | | - | 9 AssessedValuation Amount |
|---|
| 239 | | - | 10 $18,000,000to40,999,999 $37,000 |
|---|
| 240 | | - | 11 41,000,000to53,999,999 38,000 |
|---|
| 241 | | - | 12 54,000,000to65,999,999 39,000 |
|---|
| 242 | | - | 13 66,000,000to85,999,999 41,000 |
|---|
| 243 | | - | 14 86,000,000to99,999,999 43,000 |
|---|
| 244 | | - | 15 100,000,000to130,999,999 45,000 |
|---|
| 245 | | - | 16 131,000,000to159,999,999 47,000 |
|---|
| 246 | | - | 17 160,000,000to189,999,999 49,000 |
|---|
| 247 | | - | 18 190,000,000to249,999,999 51,000 |
|---|
| 248 | | - | 19 250,000,000to299,999,999 53,000 |
|---|
| 249 | | - | 20 300,000,000ormore 55,000 |
|---|
| 250 | | - | SS#2SCSHCS#2HB495 7 21 2.Twothousanddollarsofthesalaryauthorizedinthissectionshallbe |
|---|
| 251 | | - | 22 payabletotheprosecutingattorneyonlyiftheprosecutingattorneyhas |
|---|
| 252 | | - | 23 completedatleasttwentyhoursofclassroominstructioneachcalendaryear |
|---|
| 253 | | - | 24 relatingtotheoperationsoftheprosecutingattorney'sofficewhenapproved |
|---|
| 254 | | - | 25 byaprofessionalassociationofthecountyprosecutingattorneysofMissouri |
|---|
| 255 | | - | 26 unlessexemptedfromthetrainingbytheprofessionalassociation.The |
|---|
| 256 | | - | 27 professionalassociationapprovingtheprogramshallprovideacertificateof |
|---|
| 257 | | - | 28 completiontoeachprosecutingattorneywhocompletesthetrainingprogram |
|---|
| 258 | | - | 29 andshallsendalistofcertifiedprosecutingattorneystothetreasurerofeach |
|---|
| 259 | | - | 30 county.Expensesincurredforattendingthetrainingsessionmaybe |
|---|
| 260 | | - | 31 reimbursedtothecountyprosecutingattorneyinthesamemannerasother |
|---|
| 261 | | - | 32 expensesasmaybeappropriatedforthatpurpose. |
|---|
| 262 | | - | 33 3.Asusedinthissection,theterm"prosecutingattorney"includesthe |
|---|
| 263 | | - | 34 circuitattorneyofanycitynotwithinacounty. |
|---|
| 264 | | - | 35 4.Theprosecutingattorneyofanycountywhichbecomesacountyof |
|---|
| 265 | | - | 36 thefirstclassificationduringafour-yeartermofofficeoracountywhich |
|---|
| 266 | | - | 37 passedthepropositionauthorizedbysubsection1ofsection56.363shallnot |
|---|
| 267 | | - | 38 berequiredtodevotefulltimetosuchofficepursuanttosection56.067until |
|---|
| 268 | | - | 39 thebeginningoftheprosecutingattorney'snexttermofofficeoruntilthe |
|---|
| 269 | | - | 40 propositionotherwisebecomeseffective. |
|---|
| 270 | | - | 41 5.Theprovisionsofsection56.066shallnotapplytofull-time |
|---|
| 271 | | - | 42 prosecutorswhoarecompensatedpursuanttosubdivision(1)ofsubsection1 |
|---|
| 272 | | - | 43 ofthissection.] |
|---|
| 273 | | - | 56.265.1.Thecountyprosecutingattorneyinanycounty,otherthaninachartered |
|---|
| 274 | | - | 2county,shallreceiveanannualsalarycomputedusingthefollowingschedule,when |
|---|
| 275 | | - | 3applicable.Theassessedvaluationfactorshallbetheamountthereofasshownfortheyear |
|---|
| 276 | | - | 4immediatelyprecedingtheyearforwhichthecomputationisdone. |
|---|
| 277 | | - | 5 (1)Forafull-timeprosecutortheprosecutorshallreceivecompensationequaltothe |
|---|
| 278 | | - | 6compensationofanassociatecircuitjudge; |
|---|
| 279 | | - | 7 (2)Forapart-timeprosecutor: |
|---|
| 280 | | - | 8 AssessedValuation Amount |
|---|
| 281 | | - | 9 $18,000,000to40,999,999 $37,000 |
|---|
| 282 | | - | 10 41,000,000to53,999,999 38,000 |
|---|
| 283 | | - | 11 54,000,000to65,999,999 39,000 |
|---|
| 284 | | - | 12 66,000,000to85,999,999 41,000 |
|---|
| 285 | | - | 13 86,000,000to99,999,999 43,000 |
|---|
| 286 | | - | 14 100,000,000to130,999,999 45,000 |
|---|
| 287 | | - | 15 131,000,000to159,999,999 47,000 |
|---|
| 288 | | - | 16 160,000,000to189,999,999 49,000 |
|---|
| 289 | | - | 17 190,000,000to249,999,999 51,000 |
|---|
| 290 | | - | 18 250,000,000to299,999,999 53,000 |
|---|
| 291 | | - | SS#2SCSHCS#2HB495 8 19 300,000,000ormore 55,000 |
|---|
| 292 | | - | 20 2.Twothousanddollarsofthesalary[authorizedinthissection] shallbepayableto |
|---|
| 293 | | - | 21[the]anyprosecutingattorneyonlyiftheprosecutingattorneyhascompletedatleasttwenty |
|---|
| 294 | | - | 22hoursofclassroominstructioneachcalendaryearrelatingtotheoperationsoftheprosecuting |
|---|
| 295 | | - | 23attorney'sofficewhenapprovedbyaprofessionalassociationofthecountyprosecuting |
|---|
| 296 | | - | 24attorneysofMissouriunlessexemptedfromthetrainingbytheprofessionalassociation.The |
|---|
| 297 | | - | 25professionalassociationapprovingtheprogramshallprovideacertificateofcompletionto |
|---|
| 298 | | - | 26eachprosecutingattorneywhocompletesthetrainingprogramandshallsendalistof |
|---|
| 299 | | - | 27certifiedprosecutingattorneystothetreasurerofeachcountyorcitynotwithinacounty. |
|---|
| 300 | | - | 28Expensesincurredforattendingthetrainingsessionmaybereimbursedtothe[county] |
|---|
| 301 | | - | 29prosecutingattorneyinthesamemannerasotherexpensesasmaybeappropriatedforthat |
|---|
| 302 | | - | 30purpose. |
|---|
| 303 | | - | 31 3.Eachcalendaryear,fivethousanddollarsofthesalaryshallbepayabletoany |
|---|
| 304 | | - | 32prosecutingattorneyonlyiftheprosecutingattorneyhascollectedthedatadescribedin |
|---|
| 305 | | - | 33subsection2ofsection56.750inamannerapprovedbytheprosecutorscoordinators |
|---|
| 306 | | - | 34trainingcouncilandmakesthedatadescribedinsubsection2ofsection56.750readily |
|---|
| 307 | | - | 35accessibletotheMissouriofficeofprosecutionservices.TheMissouriofficeof |
|---|
| 308 | | - | 36prosecutionservicesshallprovideacertificateofcompliancetoeachprosecuting |
|---|
| 309 | | - | 37attorneywhocomplieswiththissubsectionandshallsendalistofanycertified |
|---|
| 310 | | - | 38prosecutingattorneytotherespectivetreasurerofeachcountyorcitynotwithina |
|---|
| 311 | | - | 39county. |
|---|
| 312 | | - | 40 4.Foreachcalendaryear,threethousanddollarsofthesalaryshallbepayable |
|---|
| 313 | | - | 41toanyprosecutingattorneyonlyiftheprosecutingattorneyhasprovideddiscoveryto |
|---|
| 314 | | - | 42criminaldefenseattorneyswhohaveenteredanappearanceonbehalfofadefendantin |
|---|
| 315 | | - | 43amannerapprovedbytheprosecutorscoordinatorstrainingcouncil.TheMissouri |
|---|
| 316 | | - | 44officeofprosecutionservicesshallprovideacertificateofcompliancetoeach |
|---|
| 317 | | - | 45prosecutingattorneywhocomplieswiththissubsectionandshallsendalistofany |
|---|
| 318 | | - | 46certifiedprosecutingattorneytotherespectivetreasurerofeachcountyorcitynot |
|---|
| 319 | | - | 47withinacounty. |
|---|
| 320 | | - | 48 5.Asusedinthissection,theterm"prosecutingattorney"includesthecircuitattorney |
|---|
| 321 | | - | 49ofanycitynotwithinacounty. |
|---|
| 322 | | - | 50 [4.]6.Theprosecutingattorneyofanycountywhichbecomesacountyofthefirst |
|---|
| 323 | | - | 51classificationduringafour-yeartermofofficeoracountywhichpassedtheproposition |
|---|
| 324 | | - | 52authorizedbysubsection1ofsection56.363shallnotberequiredtodevotefulltimetosuch |
|---|
| 325 | | - | 53officepursuanttosection56.067untilthebeginningoftheprosecutingattorney'snexttermof |
|---|
| 326 | | - | 54officeoruntilthepropositionotherwisebecomeseffective. |
|---|
| 327 | | - | SS#2SCSHCS#2HB495 9 55 [5.]7.Theprovisionsofsection56.066shallnotapplytofull-timeprosecutorswho |
|---|
| 328 | | - | 56arecompensatedpursuanttosubdivision(1)ofsubsection1ofthissection. |
|---|
| 329 | | - | 56.750.1.The"MissouriOfficeofProsecutionServices"isherebyestablishedasan |
|---|
| 330 | | - | 2autonomousentityintheMissouriattorneygeneral'soffice.Itshallbethepurposeofthe |
|---|
| 331 | | - | 3Missouriofficeofprosecutionservicestoassisttheprosecutingattorneysthroughoutthestate |
|---|
| 332 | | - | 4intheireffortsagainstcriminalactivityinthestate.Suchassistancemayinclude: |
|---|
| 333 | | - | 5 (1)Theobtaining,preparing,supplementing,anddisseminatingofindexestoand |
|---|
| 334 | | - | 6digestsofthedecisionsofthesupremecourtandthecourtofappealsofMissouriandother |
|---|
| 335 | | - | 7courts,andthestatutes,andotherlegalauthoritiesrelatingtocriminalmatters,andcivil |
|---|
| 336 | | - | 8mattersconcerningthedutiesofprosecutingattorneysandcircuitattorney; |
|---|
| 337 | | - | 9 (2)Thepreparationanddistributionofmodelcomplaints,informations,indictments, |
|---|
| 338 | | - | 10instructions,searchwarrants,interrogationadvices,andothercommonandappropriate |
|---|
| 339 | | - | 11documentsemployedintheadministrationofcriminaljustice; |
|---|
| 340 | | - | 12 (3)Thepreparationanddistributionofabasicprosecutor'smanualandother |
|---|
| 341 | | - | 13educationalmaterials; |
|---|
| 342 | | - | 14 (4)Thepromotionofandassistanceinthetrainingofprosecutingattorneysand |
|---|
| 343 | | - | 15circuitattorneyonastatewidebasis; |
|---|
| 344 | | - | 16 (5)Theprovisionoflegalresearchassistancetoprosecutingattorneysandcircuit |
|---|
| 345 | | - | 17attorney; |
|---|
| 346 | | - | 18 (6)Thedevelopment,supportandmaintenanceofautomatedcasemanagementand |
|---|
| 347 | | - | 19criminalhistoryreportingsystemsapprovedbytheprosecutorscoordinatorstrainingcouncil |
|---|
| 348 | | - | 20asthestandardutilizedbyprosecutingattorneysandcircuitattorney;[and] |
|---|
| 349 | | - | 21 (7)Thedevelopmentandapprovaloftheformanduniformmannerutilizingthe |
|---|
| 350 | | - | 22automatedcasemanagementsysteminwhichallreferralsrequiredbysection43.503 |
|---|
| 351 | | - | 23willbesubmittedbyanylawenforcementagencytoofficesofaprosecutingattorneyor |
|---|
| 352 | | - | 24circuitattorney;and |
|---|
| 353 | | - | 25 (8)Theprovisionofotherassistancetoprosecutingattorneysandcircuitattorneythat |
|---|
| 354 | | - | 26isnecessaryforthesuccessfulimplementationofsections56.750to56.775, including |
|---|
| 355 | | - | 27membersoftheMissouriofficeofprosecutionservicesservingasspecialprosecuting |
|---|
| 356 | | - | 28attorneysandspecialassistantprosecutingattorneys,orthathereinaftermaybe |
|---|
| 357 | | - | 29authorizedbylaw. |
|---|
| 358 | | - | 30 2.BeginningMarch31,2028,andbyMarchthirty-firstofeachyearthereafter, |
|---|
| 359 | | - | 31theMissouriofficeofprosecutionservicesshallcompileastatewidereportsummarizing |
|---|
| 360 | | - | 32fromtheautomatedcasemanagementsystem,approvedbytheprosecutors |
|---|
| 361 | | - | 33coordinatorstrainingcouncilasprovidedinsubdivision(6)ofsubsection1ofthis |
|---|
| 362 | | - | 34sectionforallofficesofprosecutingorcircuitattorneys,forthepreviouscalendaryear |
|---|
| 363 | | - | 35thefollowinginformation: |
|---|
| 364 | | - | SS#2SCSHCS#2HB495 10 36 (1)Thetotalnumberoffelonies,misdemeanors,andinfractionsreceivedbyall |
|---|
| 365 | | - | 37officesofprosecutingandcircuitattorneys,including: |
|---|
| 366 | | - | 38 (a)Thenumberofallreferralsreceivedfromlawenforcement; |
|---|
| 367 | | - | 39 (b)Thenumberofallcasesfiled; |
|---|
| 368 | | - | 40 (c)Thenumberofallcasesrefused; |
|---|
| 369 | | - | 41 (d)Thenumberofallcasesdisposed;and |
|---|
| 370 | | - | 42 (e)ThenumberofallcasesunderreviewonDecemberthirty-firstofthe |
|---|
| 371 | | - | 43calendaryearbeingreported; |
|---|
| 372 | | - | 44 (2)Anyinformationspecifictofelonies,misdemeanors,andinfractionsreceived |
|---|
| 373 | | - | 45byallofficesofprosecutingandcircuitattorneys,including: |
|---|
| 374 | | - | 46 (a)Thenumberofreferralsreceivedwhereinthemostseriouschargewasa |
|---|
| 375 | | - | 47felony; |
|---|
| 376 | | - | 48 (b)Thenumberofreferralsreceivedwhereinthemostseriouschargewasa |
|---|
| 377 | | - | 49misdemeanor; |
|---|
| 378 | | - | 50 (c)Thenumberofreferralsreceivedwhereinthemostseriouschargewasan |
|---|
| 379 | | - | 51infraction; |
|---|
| 380 | | - | 52 (d)Thenumberofreferralswithallchargesrefusedwhereinthemostserious |
|---|
| 381 | | - | 53chargereferredwasafelony; |
|---|
| 382 | | - | 54 (e)Thenumberofreferralswithallchargesrefusedwhereinthemostserious |
|---|
| 383 | | - | 55chargereferredwasamisdemeanor; |
|---|
| 384 | | - | 56 (f)Thenumberofreferralswithallchargesrefusedwhereinthemostserious |
|---|
| 385 | | - | 57chargereferredwasaninfraction; |
|---|
| 386 | | - | 58 (g)Thenumberofcasesfiledwhereinthemostseriouschargewasafelony; |
|---|
| 387 | | - | 59 (h)Thenumberofcasesfiledwhereinthemostseriouschargewasa |
|---|
| 388 | | - | 60misdemeanor; |
|---|
| 389 | | - | 61 (i)Thenumberofcasesfiledwhereinthemostseriouschargewasaninfraction; |
|---|
| 390 | | - | 62 (j)Thenumberofcasesdisposedwhereinthemostseriouschargewasafelony; |
|---|
| 391 | | - | 63 (k)Thenumberofcasesdisposedwhereinthemostseriouschargewasa |
|---|
| 392 | | - | 64misdemeanor;and |
|---|
| 393 | | - | 65 (l)Thenumberofcasesdisposedwhereinthemostseriouschargewasan |
|---|
| 394 | | - | 66infraction; |
|---|
| 395 | | - | 67 (3)Allfelonies,misdemeanors,andinfractionsreceivedbyallofficesof |
|---|
| 396 | | - | 68prosecutingandcircuitattorneysbyspecificstatutenumberandchargecode,including: |
|---|
| 397 | | - | 69 (a)Allchargesreceivedinreferralsbystatutenumberandchargecode; |
|---|
| 398 | | - | 70 (b)Allchargesfiledbystatutenumberandchargecode; |
|---|
| 399 | | - | 71 (c)Allchargesrefusedbystatutenumberandchargecode; |
|---|
| 400 | | - | 72 (d)Allchargesdisposedbystatutenumberandchargecode;and |
|---|
| 401 | | - | SS#2SCSHCS#2HB495 11 73 (e)AllchargesunderreviewonDecemberthirty-firstofthecalendaryearbeing |
|---|
| 402 | | - | 74reportedbystatutenumberandchargecode;and |
|---|
| 403 | | - | 75 (4)Eachcaseinwhichaninformant,assuchtermisdefinedbysection491.065, |
|---|
| 404 | | - | 76hasbeenendorsedbythestatetotestifyagainstadefendant'sinterestincluding: |
|---|
| 405 | | - | 77 (a)Thesubstanceofthetestimony;and |
|---|
| 406 | | - | 78 (b)Anybenefitthathasbeenrequestedbyorhasbeenofferedtotheinformant |
|---|
| 407 | | - | 79asdefinedinsection491.065,andanybenefitthatmaybeprovidedatafuturedatein |
|---|
| 408 | | - | 80connectionwithsuchtestimony. |
|---|
| 409 | | - | 81 3.Anyinformationprovidedundersubdivisions(1)to(4)ofsubsection2ofthis |
|---|
| 410 | | - | 82sectionshallbecompiledforeachindividualofficeofaprosecutingorcircuitattorney. |
|---|
| 411 | | - | 83Thesummaryreportsshallbeconsideredapublicrecord.Theindividualdataand |
|---|
| 412 | | - | 84informationcompiledbyandreceivedfromeachofficeofaprosecutingorcircuit |
|---|
| 413 | | - | 85attorneyisconfidentialandshallbeaclosedrecordandnotsubjecttoreleaseunder |
|---|
| 414 | | - | 86section610.100. |
|---|
| 415 | | - | 87 4.Anyinformationprovidedundersubdivision(4)ofsubsection2ofthissection |
|---|
| 416 | | - | 88isaccessiblebytheprosecutingorcircuitattorneyorbyanyattorneywhohasentered |
|---|
| 417 | | - | 89anappearanceonbehalfofapartytothecaseinwhichtheinformantisanendorsed |
|---|
| 418 | | - | 90witness. |
|---|
| 419 | | - | 57.010.1.Atthegeneralelectiontobeheldin1948,andateachgeneralelection |
|---|
| 420 | | - | 2heldeveryfouryearsthereafter,thevotersineverycountyinthisstateshallelectsome |
|---|
| 421 | | - | 3suitablepersonsheriff.Nopersonshallbeeligiblefortheofficeofsheriffwhohasbeen |
|---|
| 422 | | - | 4convictedofafelony.Suchpersonshallbearesidenttaxpayerandelectorofsaidcounty, |
|---|
| 423 | | - | 5shallhaveresidedinsaidcountyformorethanonewholeyearnextbeforefilingforsaid |
|---|
| 424 | | - | 6officeandshallbeapersoncapableofefficientlawenforcement.Whenanypersonshallbe |
|---|
| 425 | | - | 7electedsheriff,suchpersonshallenteruponthedischargeofthedutiesofsuchperson'soffice |
|---|
| 426 | | - | 8aschieflawenforcementofficerofthatcountyonthefirstdayofJanuarynextsucceeding |
|---|
| 427 | | - | 9saidelection. |
|---|
| 428 | | - | 10 2.Nopersonshallbeeligiblefortheofficeofsheriffwhodoesnotholdavalidpeace |
|---|
| 429 | | - | 11officerlicensepursuanttochapter590.Anypersonfilingfortheofficeofsheriffshallhavea |
|---|
| 430 | | - | 12validpeaceofficerlicenseatthetimeoffilingforoffice.Thissubsectionshallnotapplyto |
|---|
| 431 | | - | 13thesheriffofanycountyofthefirstclassificationwithacharterformofgovernmentwitha |
|---|
| 432 | | - | 14populationoverninehundredthousandorofanycitynotwithinacounty. |
|---|
| 433 | | - | 15 3.Thesheriffofanycitynotwithinacountyshallberequiredtoholdavalid |
|---|
| 434 | | - | 16peaceofficerlicensepursuanttochapter590withintwoyearsofbeingelectedassheriff. |
|---|
| 435 | | - | 82.1000.1.Inadditiontoforfeitureproceedingspursuanttosections513.600to |
|---|
| 436 | | - | 2513.645,thegoverningbodyofanyconstitutionalchartercityhavingapopulationofmore |
|---|
| 437 | | - | 3thanonehundredthousandinhabitantsandlocatedwithinacountyofthefirstclassification |
|---|
| 438 | | - | SS#2SCSHCS#2HB495 12 4thatadjoinsnoothercountyofthefirstclassificationmayenactordinanceswhichwould |
|---|
| 439 | | - | 5subjecttoforfeitureanymotorvehicleoperatedbyapersonwithoneormoreprior |
|---|
| 440 | | - | 6convictionsforanintoxication-relatedtrafficoffense,asdefinedinsection[577.023] |
|---|
| 441 | | - | 7577.001, whoisprohibitedfromobtainingalicensetooperateamotorvehiclebythedirector |
|---|
| 442 | | - | 8ofrevenuepursuanttosubdivision(9)or(10)ofsubsection1ofsection302.060,orwhohas |
|---|
| 443 | | - | 9theperson'slicensetooperateamotorvehiclesuspendedorrevoked,asaresultofafinding |
|---|
| 444 | | - | 10orapleaofguiltyto: |
|---|
| 445 | | - | 11 (1)Anyintoxication-relatedtrafficoffenseasdefinedinsection[577.023] 577.001; |
|---|
| 446 | | - | 12[or] |
|---|
| 447 | | - | 13 (2)Involuntarymanslaughterasaresultofoperatingamotorvehiclewhileinan |
|---|
| 448 | | - | 14intoxicatedconditionasdefinedinsection[565.024] 577.001; |
|---|
| 449 | | - | 15 (3)Twoormoreviolationsofstuntdrivingorstreettakeoverasprovidedin |
|---|
| 450 | | - | 16section304.145committedonseparateoccasionswhereineachviolationthepersonwas |
|---|
| 451 | | - | 17operatingavehicleandanotherpersonwasinjuredorkilled;or |
|---|
| 452 | | - | 18 (4)Theoffenseofaggravatedfleeingastopordetentionofamotorvehicleas |
|---|
| 453 | | - | 19providedinsection575.151. |
|---|
| 29 | + | Section A. Sections 43.503, 43.505, 56.750, 57.010, 1 |
|---|
| 30 | + | 82.1000, 84.020, 84.030, 84.100, 84.150, 84.160, 84.170, 2 |
|---|
| 31 | + | 84.175, 84.240, 84.341, 84.342, 84.343, 84.344, 84.345, 84.346, 3 |
|---|
| 32 | + | 84.347, 105.726, 217.825, 217.827, 217.829, 217.831, 217.833, 4 |
|---|
| 33 | + | 217.835, 217.837, 217.839, 217.841, 304.012, 455.095, 513.605, 5 |
|---|
| 34 | + | 556.061, 566.210, 566.211, 568.045, 570.030, 574.050, 575.133, 6 |
|---|
| 35 | + | 575.150, 576.030, 577.150, 590.040, 595.209, and 650.058, R SMo, 7 |
|---|
| 36 | + | and section 56.265 as enacted by senate bill no. 672, ninety -8 |
|---|
| 37 | + | 2 |
|---|
| 38 | + | seventh general assembly, second regular session, and section 9 |
|---|
| 39 | + | 56.265 as enacted by senate bill no. 275, ninetieth general 10 |
|---|
| 40 | + | assembly, first regular session, are repealed and forty -two new 11 |
|---|
| 41 | + | sections enacted in lieu thereof, to be known as sections 12 |
|---|
| 42 | + | 43.503, 43.505, 44.087, 56.265, 56.750, 57.010, 82.1000, 13 |
|---|
| 43 | + | 84.012, 84.020, 84.030, 84.100, 84.150, 84.160, 84.170, 84.225, 14 |
|---|
| 44 | + | 84.325, 105.726, 191.1005, 217.451, 221.108, 221.520, 221.523, 15 |
|---|
| 45 | + | 304.012, 304.145, 455.095, 491.065, 513.605, 556.061, 566.210, 16 |
|---|
| 46 | + | 566.211, 568.045, 570.030, 575.133, 575.150, 576.030, 577.150, 17 |
|---|
| 47 | + | 590.040, 590.208, 595.209, 595.325, 650.058, and 1, to read as 18 |
|---|
| 48 | + | follows:19 |
|---|
| 49 | + | 43.503. 1. For the purpose of maintaining complete 1 |
|---|
| 50 | + | and accurate criminal history record information, all police 2 |
|---|
| 51 | + | officers of this state, the clerk of each court, the 3 |
|---|
| 52 | + | department of corrections, the sheriff of each county, the 4 |
|---|
| 53 | + | chief law enforcement official of a city not within a county 5 |
|---|
| 54 | + | and the prosecuting attorney of ea ch county or the circuit 6 |
|---|
| 55 | + | attorney of a city not within a county shall submit certain 7 |
|---|
| 56 | + | criminal arrest, charge, and disposition information to the 8 |
|---|
| 57 | + | central repository for filing without undue delay in the 9 |
|---|
| 58 | + | form and manner required by sections 43.500 to 43. 651. 10 |
|---|
| 59 | + | 2. All law enforcement agencies making misdemeanor and 11 |
|---|
| 60 | + | felony arrests as determined by section 43.506 shall furnish 12 |
|---|
| 61 | + | without undue delay, to the central repository, 13 |
|---|
| 62 | + | fingerprints, photograph, and if available, any other unique 14 |
|---|
| 63 | + | biometric identification collected, charges, appropriate 15 |
|---|
| 64 | + | charge codes, and descriptions of all persons who are 16 |
|---|
| 65 | + | arrested for such offenses on standard fingerprint forms 17 |
|---|
| 66 | + | supplied or approved by the highway patrol or electronically 18 |
|---|
| 67 | + | in a format and manner approved by the highway patrol and in 19 |
|---|
| 68 | + | compliance with the standards set by the Federal Bureau of 20 |
|---|
| 69 | + | Investigation in its Automated Fingerprint Identification 21 |
|---|
| 70 | + | System or its successor program. All such agencies shall 22 |
|---|
| 71 | + | 3 |
|---|
| 72 | + | also notify the central repository of all decisions not to 23 |
|---|
| 73 | + | refer such arrests for prosecution. An agency making such 24 |
|---|
| 74 | + | arrests may enter into arrangements with other law 25 |
|---|
| 75 | + | enforcement agencies for the purpose of furnishing without 26 |
|---|
| 76 | + | undue delay such fingerprints, photograph, and if available, 27 |
|---|
| 77 | + | any other unique biometric identification collected, 28 |
|---|
| 78 | + | charges, appropriate charge codes, and descriptions to the 29 |
|---|
| 79 | + | central repository upon its behalf. 30 |
|---|
| 80 | + | 3. In order for the Missouri office of prosecution 31 |
|---|
| 81 | + | services to maintain complete and accurate statewide reports 32 |
|---|
| 82 | + | as required by section 56.750, on or before January 1, 2028, 33 |
|---|
| 83 | + | and thereafter, all police officers of this state, the 34 |
|---|
| 84 | + | sheriff and each deputy sheriff of each county, and the 35 |
|---|
| 85 | + | chief law enforcement official of a city not within a county 36 |
|---|
| 86 | + | and his or her officer s shall submit referrals for any 37 |
|---|
| 87 | + | traffic violation, ordinance violation, or misdemeanor or 38 |
|---|
| 88 | + | felony offense referred to a prosecuting or circuit attorney 39 |
|---|
| 89 | + | in the form and manner approved by the Missouri office of 40 |
|---|
| 90 | + | prosecution services as required by subdiv ision (7) of 41 |
|---|
| 91 | + | subsection 1 of section 56.750. At a minimum, any referral 42 |
|---|
| 92 | + | to a prosecuting attorney or circuit attorney for a felony 43 |
|---|
| 93 | + | offense shall include a probable cause statement and an 44 |
|---|
| 94 | + | investigative report. Any law enforcement agency that 45 |
|---|
| 95 | + | violates this subsection shall be ineligible to receive 46 |
|---|
| 96 | + | state or federal funds that would otherwise be paid to such 47 |
|---|
| 97 | + | agency for law enforcement, safety, or criminal justice 48 |
|---|
| 98 | + | purposes. 49 |
|---|
| 99 | + | 4. In instances where an individual less than 50 |
|---|
| 100 | + | seventeen years of age and not currently certified as an 51 |
|---|
| 101 | + | adult is taken into custody for an offense which would be a 52 |
|---|
| 102 | + | felony if committed by an adult, the arresting officer shall 53 |
|---|
| 103 | + | take fingerprints for the central repository. These 54 |
|---|
| 104 | + | fingerprints shall be taken on fingerprint card s supplied by 55 |
|---|
| 105 | + | 4 |
|---|
| 106 | + | or approved by the highway patrol or transmitted 56 |
|---|
| 107 | + | electronically in a format and manner approved by the 57 |
|---|
| 108 | + | highway patrol and in compliance with the standards set by 58 |
|---|
| 109 | + | the Federal Bureau of Investigation in its Automated 59 |
|---|
| 110 | + | Fingerprint Identifica tion System or its successor program. 60 |
|---|
| 111 | + | The fingerprint cards shall be so constructed that the name 61 |
|---|
| 112 | + | of the juvenile should not be made available to the central 62 |
|---|
| 113 | + | repository. The individual's name and the unique number 63 |
|---|
| 114 | + | associated with the fingerprints and other pertinent 64 |
|---|
| 115 | + | information shall be provided to the court of jurisdiction 65 |
|---|
| 116 | + | by the agency taking the juvenile into custody. The 66 |
|---|
| 117 | + | juvenile's fingerprints and other information shall be 67 |
|---|
| 118 | + | forwarded to the central repository and the courts without 68 |
|---|
| 119 | + | undue delay. The fingerprint information from the card 69 |
|---|
| 120 | + | shall be captured and stored in the automated fingerprint 70 |
|---|
| 121 | + | identification system operated by the central repository. 71 |
|---|
| 122 | + | In the event the fingerprints are found to match other 72 |
|---|
| 123 | + | tenprints or unsolved latent pri nts, the central repository 73 |
|---|
| 124 | + | shall notify the submitting agency who shall notify the 74 |
|---|
| 125 | + | court of jurisdiction as per local agreement. Under section 75 |
|---|
| 126 | + | 211.031, in instances where a juvenile over fifteen and one - 76 |
|---|
| 127 | + | half years of age is alleged to have violated a state or 77 |
|---|
| 128 | + | municipal traffic ordinance or regulation, which does not 78 |
|---|
| 129 | + | constitute a felony, and the juvenile court does not have 79 |
|---|
| 130 | + | jurisdiction, the juvenile shall not be fingerprinted unless 80 |
|---|
| 131 | + | certified as an adult. 81 |
|---|
| 132 | + | [4.] 5. Upon certification of the in dividual as an 82 |
|---|
| 133 | + | adult, the certifying court shall order a law enforcement 83 |
|---|
| 134 | + | agency to immediately fingerprint and photograph the 84 |
|---|
| 135 | + | individual and certification papers will be forwarded to the 85 |
|---|
| 136 | + | appropriate law enforcement agency with the order for 86 |
|---|
| 137 | + | fingerprinting. The law enforcement agency shall submit 87 |
|---|
| 138 | + | such fingerprints, photograph, and certification papers to 88 |
|---|
| 139 | + | 5 |
|---|
| 140 | + | the central repository within fifteen days and shall furnish 89 |
|---|
| 141 | + | the offense cycle number associated with the fingerprints to 90 |
|---|
| 142 | + | the prosecuting attorney or the circuit attorney of a city 91 |
|---|
| 143 | + | not within a county and to the clerk of the court ordering 92 |
|---|
| 144 | + | the subject fingerprinted. If the juvenile is acquitted of 93 |
|---|
| 145 | + | the crime and is no longer certified as an adult, the 94 |
|---|
| 146 | + | prosecuting attorney shall notify within fif teen days the 95 |
|---|
| 147 | + | central repository of the change of status of the juvenile. 96 |
|---|
| 148 | + | Records of a child who has been fingerprinted and 97 |
|---|
| 149 | + | photographed after being taken into custody shall be closed 98 |
|---|
| 150 | + | records as provided under section 610.100 if a petition has 99 |
|---|
| 151 | + | not been filed within thirty days of the date that the child 100 |
|---|
| 152 | + | was taken into custody; and if a petition for the child has 101 |
|---|
| 153 | + | not been filed within one year of the date the child was 102 |
|---|
| 154 | + | taken into custody, any records relating to the child 103 |
|---|
| 155 | + | concerning the alleged off ense may be expunged under the 104 |
|---|
| 156 | + | procedures in sections 610.122 to 610.126. 105 |
|---|
| 157 | + | [5.] 6. The prosecuting attorney of each county or the 106 |
|---|
| 158 | + | circuit attorney of a city not within a county or the 107 |
|---|
| 159 | + | municipal prosecuting attorney shall notify the central 108 |
|---|
| 160 | + | repository on standard forms supplied by the highway patrol 109 |
|---|
| 161 | + | or in a manner approved by the highway patrol of his or her 110 |
|---|
| 162 | + | decision to not file a criminal charge on any charge 111 |
|---|
| 163 | + | referred to such prosecuting attorney or circuit attorney 112 |
|---|
| 164 | + | for criminal charges. All records forwarded to the central 113 |
|---|
| 165 | + | repository and the courts by prosecutors or circuit 114 |
|---|
| 166 | + | attorneys as required by sections 43.500 to 43.530 shall 115 |
|---|
| 167 | + | include the state offense cycle number of the offense, the 116 |
|---|
| 168 | + | charge code for the offense, and the originating age ncy 117 |
|---|
| 169 | + | identifier number of the reporting prosecutor, using such 118 |
|---|
| 170 | + | numbers as assigned by the highway patrol. 119 |
|---|
| 171 | + | [6.] 7. The clerk of the courts of each county or city 120 |
|---|
| 172 | + | not within a county or municipal court clerk shall furnish 121 |
|---|
| 173 | + | 6 |
|---|
| 174 | + | the central repository, on standard forms supplied by the 122 |
|---|
| 175 | + | highway patrol or in a manner approved by the highway 123 |
|---|
| 176 | + | patrol, with a record of all charges filed, including all 124 |
|---|
| 177 | + | those added subsequent to the filing of a criminal court 125 |
|---|
| 178 | + | case, amended charges, and all final dispositions of cases 126 |
|---|
| 179 | + | for which the central repository has a record of an arrest 127 |
|---|
| 180 | + | or a record of fingerprints reported pursuant to sections 128 |
|---|
| 181 | + | 43.500 to 43.506. Such information shall include, for each 129 |
|---|
| 182 | + | charge: 130 |
|---|
| 183 | + | (1) All judgments of not guilty, acquittals on the 131 |
|---|
| 184 | + | ground of mental disease or defect excluding responsibility, 132 |
|---|
| 185 | + | judgments or pleas of guilty including the sentence, if any, 133 |
|---|
| 186 | + | or probation, if any, pronounced by the court, nolle pros, 134 |
|---|
| 187 | + | discharges, releases and dismissals in the trial court; 135 |
|---|
| 188 | + | (2) Court orders filed with the clerk of the courts 136 |
|---|
| 189 | + | which reverse a reported conviction or vacate or modify a 137 |
|---|
| 190 | + | sentence; 138 |
|---|
| 191 | + | (3) Judgments terminating or revoking a sentence to 139 |
|---|
| 192 | + | probation, supervision or conditional release and any 140 |
|---|
| 193 | + | resentencing after such revocati on; and 141 |
|---|
| 194 | + | (4) The offense cycle number of the offense, and the 142 |
|---|
| 195 | + | originating agency identifier number of the sentencing 143 |
|---|
| 196 | + | court, using such numbers as assigned by the highway patrol. 144 |
|---|
| 197 | + | [7.] 8. The clerk of the courts of each county or city 145 |
|---|
| 198 | + | not within a county shall furnish, to the department of 146 |
|---|
| 199 | + | corrections or department of mental health, court judgment 147 |
|---|
| 200 | + | and sentence documents and the state offense cycle number 148 |
|---|
| 201 | + | and the charge code of the offense which resulted in the 149 |
|---|
| 202 | + | commitment or assignment of an offender to the jurisdiction 150 |
|---|
| 203 | + | of the department of corrections or the department of mental 151 |
|---|
| 204 | + | health if the person is committed pursuant to chapter 552. 152 |
|---|
| 205 | + | This information shall be reported to the department of 153 |
|---|
| 206 | + | corrections or the department of mental health at the time 154 |
|---|
| 207 | + | 7 |
|---|
| 208 | + | of commitment or assignment. If the offender was already in 155 |
|---|
| 209 | + | the custody of the department of corrections or the 156 |
|---|
| 210 | + | department of mental health at the time of such subsequent 157 |
|---|
| 211 | + | conviction, the clerk shall furnish notice of such 158 |
|---|
| 212 | + | subsequent conviction to the appropriate department by 159 |
|---|
| 213 | + | certified mail, return receipt requested, or in a manner and 160 |
|---|
| 214 | + | format mutually agreed to, within fifteen days of such 161 |
|---|
| 215 | + | disposition. 162 |
|---|
| 216 | + | [8.] 9. Information and fingerprints, photograph and 163 |
|---|
| 217 | + | if available, any other unique biometric identification 164 |
|---|
| 218 | + | collected, forwarded to the central repository, normally 165 |
|---|
| 219 | + | obtained from a person at the time of the arrest, may be 166 |
|---|
| 220 | + | obtained at any time the subject is in the criminal justice 167 |
|---|
| 221 | + | system or committed to the department of menta l health. A 168 |
|---|
| 222 | + | law enforcement agency or the department of corrections may 169 |
|---|
| 223 | + | fingerprint, photograph, and capture any other unique 170 |
|---|
| 224 | + | biometric identification of the person unless collecting 171 |
|---|
| 225 | + | other unique biometric identification of the person is not 172 |
|---|
| 226 | + | financially feasible for the law enforcement agency, and 173 |
|---|
| 227 | + | obtain the necessary information at any time the subject is 174 |
|---|
| 228 | + | in custody. If at the time of any court appearance, the 175 |
|---|
| 229 | + | defendant has not been fingerprinted and photographed for an 176 |
|---|
| 230 | + | offense in which a finger print and photograph is required by 177 |
|---|
| 231 | + | statute to be collected, maintained, or disseminated by the 178 |
|---|
| 232 | + | central repository, the court shall order a law enforcement 179 |
|---|
| 233 | + | agency or court marshal to fingerprint and photograph 180 |
|---|
| 234 | + | immediately the defendant. The order for fingerprints shall 181 |
|---|
| 235 | + | contain the offense, charge code, date of offense, and any 182 |
|---|
| 236 | + | other information necessary to complete the fingerprint 183 |
|---|
| 237 | + | card. The law enforcement agency or court marshal shall 184 |
|---|
| 238 | + | submit such fingerprints, photograph, and if available, any 185 |
|---|
| 239 | + | other unique biometric identification collected, to the 186 |
|---|
| 240 | + | central repository without undue delay and within thirty 187 |
|---|
| 241 | + | 8 |
|---|
| 242 | + | days and shall furnish the offense cycle number associated 188 |
|---|
| 243 | + | with the fingerprints to the prosecuting attorney or the 189 |
|---|
| 244 | + | circuit attorney of a c ity not within a county and to the 190 |
|---|
| 245 | + | court clerk of the court ordering the subject fingerprinted. 191 |
|---|
| 246 | + | [9.] 10. The department of corrections and the 192 |
|---|
| 247 | + | department of mental health shall furnish the central 193 |
|---|
| 248 | + | repository with all information concerning the rec eipt, 194 |
|---|
| 249 | + | escape, execution, death, release, pardon, parole, 195 |
|---|
| 250 | + | commutation of sentence, granting of executive clemency, 196 |
|---|
| 251 | + | legal name change, or discharge of an individual who has 197 |
|---|
| 252 | + | been sentenced to that department's custody for any offenses 198 |
|---|
| 253 | + | which are mandated by law to be collected, maintained or 199 |
|---|
| 254 | + | disseminated by the central repository. All records 200 |
|---|
| 255 | + | forwarded to the central repository by the department as 201 |
|---|
| 256 | + | required by sections 43.500 to 43.651 shall include the 202 |
|---|
| 257 | + | offense cycle number of the offense, and the ori ginating 203 |
|---|
| 258 | + | agency identifier number of the department using such 204 |
|---|
| 259 | + | numbers as assigned by the highway patrol. 205 |
|---|
| 260 | + | 43.505. 1. The department of public safety is hereby 1 |
|---|
| 261 | + | designated as the central repository for the collection, 2 |
|---|
| 262 | + | maintenance, analysis and reporting of crime incident 3 |
|---|
| 263 | + | activity generated by law enforcement agencies in this 4 |
|---|
| 264 | + | state. The department shall develop and operate a uniform 5 |
|---|
| 265 | + | crime reporting system that is compatible with the national 6 |
|---|
| 266 | + | uniform crime reporting system operat ed by the Federal 7 |
|---|
| 267 | + | Bureau of Investigation. 8 |
|---|
| 268 | + | 2. The department of public safety shall: 9 |
|---|
| 269 | + | (1) Develop, operate and maintain an information 10 |
|---|
| 270 | + | system for the collection, storage, maintenance, analysis 11 |
|---|
| 271 | + | and retrieval of crime incident and arrest report s from 12 |
|---|
| 272 | + | Missouri law enforcement agencies; 13 |
|---|
| 273 | + | (2) Compile the statistical data and forward such data 14 |
|---|
| 274 | + | as required to the Federal Bureau of Investigation or the 15 |
|---|
| 275 | + | 9 |
|---|
| 276 | + | appropriate Department of Justice agency in accordance with 16 |
|---|
| 277 | + | the standards and procedures of the national system; 17 |
|---|
| 278 | + | (3) Provide the forms, formats, procedures, standards 18 |
|---|
| 279 | + | and related training or training assistance to all law 19 |
|---|
| 280 | + | enforcement agencies in the state as necessary for such 20 |
|---|
| 281 | + | agencies to report incident and arrest activity for timely 21 |
|---|
| 282 | + | inclusion into the statewide system; 22 |
|---|
| 283 | + | (4) Annually publish a report on the nature and extent 23 |
|---|
| 284 | + | of crime and submit such report to the governor and the 24 |
|---|
| 285 | + | general assembly. Such report and other statistical reports 25 |
|---|
| 286 | + | shall be made available to state and l ocal law enforcement 26 |
|---|
| 287 | + | agencies and the general public through an electronic or 27 |
|---|
| 288 | + | manual medium; 28 |
|---|
| 289 | + | (5) Maintain the privacy and security of information 29 |
|---|
| 290 | + | in accordance with applicable state and federal laws, 30 |
|---|
| 291 | + | regulations and orders; and 31 |
|---|
| 292 | + | (6) Establish such rules and regulations as are 32 |
|---|
| 293 | + | necessary for implementing the provisions of this section. 33 |
|---|
| 294 | + | Any rule or portion of a rule, as that term is defined in 34 |
|---|
| 295 | + | section 536.010, that is created under the authority 35 |
|---|
| 296 | + | delegated in this section shall become effect ive only if it 36 |
|---|
| 297 | + | complies with and is subject to all of the provisions of 37 |
|---|
| 298 | + | chapter 536 and, if applicable, section 536.028. This 38 |
|---|
| 299 | + | section and chapter 536 are nonseverable and if any of the 39 |
|---|
| 300 | + | powers vested with the general assembly pursuant to chapter 40 |
|---|
| 301 | + | 536 to review, to delay the effective date or to disapprove 41 |
|---|
| 302 | + | and annul a rule are subsequently held unconstitutional, 42 |
|---|
| 303 | + | then the grant of rulemaking authority and any rule proposed 43 |
|---|
| 304 | + | or adopted after August 28, 2000, shall be invalid and void. 44 |
|---|
| 305 | + | 3. Every law enforcement agency in the state shall: 45 |
|---|
| 306 | + | (1) Submit crime incident reports to the department of 46 |
|---|
| 307 | + | public safety on forms or in the format prescribed by the 47 |
|---|
| 308 | + | department; and 48 |
|---|
| 309 | + | 10 |
|---|
| 310 | + | (2) Submit any other crime incident information which 49 |
|---|
| 311 | + | may be required by the department of public safety , 50 |
|---|
| 312 | + | including information pertaining to the citizen or 51 |
|---|
| 313 | + | immigration status of any person arrested for an offense 52 |
|---|
| 314 | + | that is reportable under section 43.506 . 53 |
|---|
| 315 | + | 4. Any law enforcement agency that violates this 54 |
|---|
| 316 | + | section after December 31, 2021, may be ineligible to 55 |
|---|
| 317 | + | receive state or federal funds which would otherwise be paid 56 |
|---|
| 318 | + | to such agency for law enforcement, safety or criminal 57 |
|---|
| 319 | + | justice purposes. 58 |
|---|
| 320 | + | 44.087. 1. The chief law enforcement executive for 1 |
|---|
| 321 | + | any law enforcement agency, or such executive's designee, 2 |
|---|
| 322 | + | may request assistance from a law enforcement agency of 3 |
|---|
| 323 | + | another jurisdiction, including a jurisdiction outside the 4 |
|---|
| 324 | + | state of Missouri but within the United States. 5 |
|---|
| 325 | + | 2. If a law enforcement officer makes an arrest or 6 |
|---|
| 326 | + | apprehension outside such officer's jurisdiction, the 7 |
|---|
| 327 | + | offender shall be delivered to the first available law 8 |
|---|
| 328 | + | enforcement officer who is commissioned in the jurisdiction 9 |
|---|
| 329 | + | in which the arrest was made. The officer making the 10 |
|---|
| 330 | + | initial arrest or apprehension shall assist in the 11 |
|---|
| 331 | + | preparation of any affidavits filed with the complaint or 12 |
|---|
| 332 | + | based on other evidence that there is probable cause to 13 |
|---|
| 333 | + | believe that both a crime has been committed and the 14 |
|---|
| 334 | + | defendant has committed such crime. 15 |
|---|
| 335 | + | 3. For the purpose of liability, workers' 16 |
|---|
| 336 | + | compensation, and any other employment -related matter, law 17 |
|---|
| 337 | + | enforcement officers remain employees of their respective 18 |
|---|
| 338 | + | law enforcement agency throughout any request for 19 |
|---|
| 339 | + | assistance. Qualified immunity, sovereign immunity, 20 |
|---|
| 340 | + | official immunity, and the public duty rule shall apply to 21 |
|---|
| 341 | + | the provisions of this section as interpreted by the federal 22 |
|---|
| 342 | + | and state courts of the responding agency. 23 |
|---|
| 343 | + | 11 |
|---|
| 344 | + | 4. Nothing in this section shall be construed to limit 24 |
|---|
| 345 | + | the actions of law enforcement officers or agencies 25 |
|---|
| 346 | + | conducted in accordance with section 44.095 or 44.098, or 26 |
|---|
| 347 | + | any other mutual aid agreement made under this chapter. 27 |
|---|
| 348 | + | 5. The provisions of chapter 544 are applicable to any 28 |
|---|
| 349 | + | law enforcement officers from jurisdictions located outside 29 |
|---|
| 350 | + | the state of Missouri, but within the United States, who are 30 |
|---|
| 351 | + | acting pursuant to a request made under this section. 31 |
|---|
| 352 | + | [56.265. 1. The county prosecuting 1 |
|---|
| 353 | + | attorney in any county, other than in a 2 |
|---|
| 354 | + | chartered county, shall receive an annual salary 3 |
|---|
| 355 | + | computed using the following schedule, when 4 |
|---|
| 356 | + | applicable. The assessed valuation factor shall 5 |
|---|
| 357 | + | be the amount thereof as shown for the year 6 |
|---|
| 358 | + | immediately preceding the year for which the 7 |
|---|
| 359 | + | computation is done. 8 |
|---|
| 360 | + | (1) For a full-time prosecutor the 9 |
|---|
| 361 | + | prosecutor shall receive compensation equal to 10 |
|---|
| 362 | + | the compensation of an associate circuit judge; 11 |
|---|
| 363 | + | (2) For a part-time prosecutor: 12 |
|---|
| 364 | + | 13 Assessed Valuation Amount |
|---|
| 365 | + | 14 $18,000,000 to 40,999,999 $37,000 |
|---|
| 366 | + | 15 41,000,000 to 53,999,999 38,000 |
|---|
| 367 | + | 16 54,000,000 to 65,999,999 39,000 |
|---|
| 368 | + | 17 66,000,000 to 85,999,999 41,000 |
|---|
| 369 | + | 18 86,000,000 to 99,999,999 43,000 |
|---|
| 370 | + | 19 100,000,000 to 130,999,999 45,000 |
|---|
| 371 | + | 20 131,000,000 to 159,999,999 47,000 |
|---|
| 372 | + | 21 160,000,000 to 189,999,999 49,000 |
|---|
| 373 | + | 22 190,000,000 to 249,999,999 51,000 |
|---|
| 374 | + | 23 250,000,000 to 299,999,999 53,000 |
|---|
| 375 | + | 12 |
|---|
| 376 | + | [2. Two thousand dollars of the salary 25 |
|---|
| 377 | + | authorized in this section shall be payable to 26 |
|---|
| 378 | + | the prosecuting attorney only if the prosecuting 27 |
|---|
| 379 | + | attorney has completed at least twenty hours of 28 |
|---|
| 380 | + | classroom instruction each calendar year 29 |
|---|
| 381 | + | relating to the operations of the prosecuting 30 |
|---|
| 382 | + | attorney's office when approved by a 31 |
|---|
| 383 | + | professional association of the county 32 |
|---|
| 384 | + | prosecuting attorneys of Missouri unless 33 |
|---|
| 385 | + | exempted from the training by the professional 34 |
|---|
| 386 | + | association. The professional association 35 |
|---|
| 387 | + | approving the program shall provide a 36 |
|---|
| 388 | + | certificate of completion to each prosecuting 37 |
|---|
| 389 | + | attorney who completes the training program and 38 |
|---|
| 390 | + | shall send a list of certified prosecuting 39 |
|---|
| 391 | + | attorneys to the treasurer of each county. 40 |
|---|
| 392 | + | Expenses incurred for attending the training 41 |
|---|
| 393 | + | session may be reimbursed to the coun ty 42 |
|---|
| 394 | + | prosecuting attorney in the same manner as other 43 |
|---|
| 395 | + | expenses as may be appropriated for that purpose. 44 |
|---|
| 396 | + | 3. As used in this section, the term 45 |
|---|
| 397 | + | "prosecuting attorney" includes the circuit 46 |
|---|
| 398 | + | attorney of any city not within a county. 47 |
|---|
| 399 | + | 4. The prosecuting attorney of any county 48 |
|---|
| 400 | + | which becomes a county of the first 49 |
|---|
| 401 | + | classification during a four -year term of office 50 |
|---|
| 402 | + | or a county which passed the proposition 51 |
|---|
| 403 | + | authorized by subsection 1 of section 56.363 52 |
|---|
| 404 | + | shall not be required to devote full time to 53 |
|---|
| 405 | + | such office pursuant to section 56.067 until the 54 |
|---|
| 406 | + | beginning of the prosecuting attorney's next 55 |
|---|
| 407 | + | term of office or until the proposition 56 |
|---|
| 408 | + | otherwise becomes effective. 57 |
|---|
| 409 | + | 5. The provisions of section 56.066 shall 58 |
|---|
| 410 | + | not apply to full-time prosecutors who are 59 |
|---|
| 411 | + | compensated pursuant to subdivision (1) of 60 |
|---|
| 412 | + | subsection 1 of this section. ] 61 |
|---|
| 413 | + | 56.265. 1. The county prosecuting attorney in any 1 |
|---|
| 414 | + | county, other than in a chartered county, shall receive an 2 |
|---|
| 415 | + | annual salary computed using the following schedu le, when 3 |
|---|
| 416 | + | applicable. The assessed valuation factor shall be the 4 |
|---|
| 417 | + | 24 300,000,000 or more 55,000 ] |
|---|
| 418 | + | 13 |
|---|
| 419 | + | amount thereof as shown for the year immediately preceding 5 |
|---|
| 420 | + | the year for which the computation is done. 6 |
|---|
| 421 | + | (1) For a full-time prosecutor the prosecutor shall 7 |
|---|
| 422 | + | receive compensation equal to the compensation of an 8 |
|---|
| 423 | + | associate circuit judge; 9 |
|---|
| 424 | + | (2) For a part-time prosecutor: 10 |
|---|
| 425 | + | 2. Two thousand dollars of the salary [authorized in 23 |
|---|
| 426 | + | this section] shall be payable to [the] any prosecuting 24 |
|---|
| 427 | + | attorney only if the prosecuting attorney has completed at 25 |
|---|
| 428 | + | least twenty hours of classroom instruction each calendar 26 |
|---|
| 429 | + | year relating to the operations of the prosecuting 27 |
|---|
| 430 | + | attorney's office when approved by a professional 28 |
|---|
| 431 | + | association of the county prosecut ing attorneys of Missouri 29 |
|---|
| 432 | + | unless exempted from the training by the professional 30 |
|---|
| 433 | + | association. The professional association approving the 31 |
|---|
| 434 | + | 11 Assessed Valuation Amount |
|---|
| 435 | + | 12 $18,000,000 to 40,999,999 $37,000 |
|---|
| 436 | + | 13 41,000,000 to 53,999,999 38,000 |
|---|
| 437 | + | 14 54,000,000 to 65,999,999 39,000 |
|---|
| 438 | + | 15 66,000,000 to 85,999,999 41,000 |
|---|
| 439 | + | 16 86,000,000 to 99,999,999 43,000 |
|---|
| 440 | + | 17 100,000,000 to 130,999,999 45,000 |
|---|
| 441 | + | 18 131,000,000 to 159,999,999 47,000 |
|---|
| 442 | + | 19 160,000,000 to 189,999,999 49,000 |
|---|
| 443 | + | 20 190,000,000 to 249,999,999 51,000 |
|---|
| 444 | + | 21 250,000,000 to 299,999,999 53,000 |
|---|
| 445 | + | 22 300,000,000 or more 55,000 |
|---|
| 446 | + | 14 |
|---|
| 447 | + | program shall provide a certificate of completion to each 32 |
|---|
| 448 | + | prosecuting attorney who completes the training program a nd 33 |
|---|
| 449 | + | shall send a list of certified prosecuting attorneys to the 34 |
|---|
| 450 | + | treasurer of each county or city not within a county . 35 |
|---|
| 451 | + | Expenses incurred for attending the training session may be 36 |
|---|
| 452 | + | reimbursed to the [county] prosecuting attorney in the same 37 |
|---|
| 453 | + | manner as other expenses as may be appropriated for that 38 |
|---|
| 454 | + | purpose. 39 |
|---|
| 455 | + | 3. Each calendar year, five thousand dollars of the 40 |
|---|
| 456 | + | salary shall be payable to any prosecuting attorney only if 41 |
|---|
| 457 | + | the prosecuting attorney has collected the data described in 42 |
|---|
| 458 | + | subsection 2 of sect ion 56.750 in a manner approved by the 43 |
|---|
| 459 | + | prosecutors coordinators training council and makes the data 44 |
|---|
| 460 | + | described in subsection 2 of section 56.750 readily 45 |
|---|
| 461 | + | accessible to the Missouri office of prosecution services. 46 |
|---|
| 462 | + | The Missouri office of prosecution servi ces shall provide a 47 |
|---|
| 463 | + | certificate of compliance to each prosecuting attorney who 48 |
|---|
| 464 | + | complies with this subsection and shall send a list of any 49 |
|---|
| 465 | + | certified prosecuting attorney to the respective treasurer 50 |
|---|
| 466 | + | of each county or city not within a county. 51 |
|---|
| 467 | + | 4. For each calendar year, three thousand dollars of 52 |
|---|
| 468 | + | the salary shall be payable to any prosecuting attorney only 53 |
|---|
| 469 | + | if the prosecuting attorney has provided discovery to 54 |
|---|
| 470 | + | criminal defense attorneys who have entered an appearance on 55 |
|---|
| 471 | + | behalf of a defendant in a m anner approved by the 56 |
|---|
| 472 | + | prosecutors coordinators training council. The Missouri 57 |
|---|
| 473 | + | office of prosecution services shall provide a certificate 58 |
|---|
| 474 | + | of compliance to each prosecuting attorney who complies with 59 |
|---|
| 475 | + | this subsection and shall send a list of any certifie d 60 |
|---|
| 476 | + | prosecuting attorney to the respective treasurer of each 61 |
|---|
| 477 | + | county or city not within a county. 62 |
|---|
| 478 | + | 15 |
|---|
| 479 | + | 5. As used in this section, the term "prosecuting 63 |
|---|
| 480 | + | attorney" includes the circuit attorney of any city not 64 |
|---|
| 481 | + | within a county. 65 |
|---|
| 482 | + | [4.] 6. The prosecuting attorney of any county which 66 |
|---|
| 483 | + | becomes a county of the first classification during a four - 67 |
|---|
| 484 | + | year term of office or a county which passed the proposition 68 |
|---|
| 485 | + | authorized by subsection 1 of section 56.363 shall not be 69 |
|---|
| 486 | + | required to devote full time to such office pursuant to 70 |
|---|
| 487 | + | section 56.067 until the beginning of the prosecuting 71 |
|---|
| 488 | + | attorney's next term of office or until the proposition 72 |
|---|
| 489 | + | otherwise becomes effective. 73 |
|---|
| 490 | + | [5.] 7. The provisions of section 56.066 shall not 74 |
|---|
| 491 | + | apply to full-time prosecutors who are comp ensated pursuant 75 |
|---|
| 492 | + | to subdivision (1) of subsection 1 of this section. 76 |
|---|
| 493 | + | 56.750. 1. The "Missouri Office of Prosecution 1 |
|---|
| 494 | + | Services" is hereby established as an autonomous entity in 2 |
|---|
| 495 | + | the Missouri attorney general's office. It shall be the 3 |
|---|
| 496 | + | purpose of the Missouri office of prosecution services to 4 |
|---|
| 497 | + | assist the prosecuting attorneys throughout the state in 5 |
|---|
| 498 | + | their efforts against criminal activity in the state. Such 6 |
|---|
| 499 | + | assistance may include: 7 |
|---|
| 500 | + | (1) The obtaining, preparing, supplementing , and 8 |
|---|
| 501 | + | disseminating of indexes to and digests of the decisions of 9 |
|---|
| 502 | + | the supreme court and the court of appeals of Missouri and 10 |
|---|
| 503 | + | other courts, and the statutes, and other legal authorities 11 |
|---|
| 504 | + | relating to criminal matters, and civil matters concerning 12 |
|---|
| 505 | + | the duties of prosecuting attorneys and circuit attorney; 13 |
|---|
| 506 | + | (2) The preparation and distribution of model 14 |
|---|
| 507 | + | complaints, informations, indictments, instructions, search 15 |
|---|
| 508 | + | warrants, interrogation advices, and other common and 16 |
|---|
| 509 | + | appropriate documents employed in th e administration of 17 |
|---|
| 510 | + | criminal justice; 18 |
|---|
| 511 | + | 16 |
|---|
| 512 | + | (3) The preparation and distribution of a basic 19 |
|---|
| 513 | + | prosecutor's manual and other educational materials; 20 |
|---|
| 514 | + | (4) The promotion of and assistance in the training of 21 |
|---|
| 515 | + | prosecuting attorneys and circuit attorney on a statewide 22 |
|---|
| 516 | + | basis; 23 |
|---|
| 517 | + | (5) The provision of legal research assistance to 24 |
|---|
| 518 | + | prosecuting attorneys and circuit attorney; 25 |
|---|
| 519 | + | (6) The development, support and maintenance of 26 |
|---|
| 520 | + | automated case management and criminal history reporting 27 |
|---|
| 521 | + | systems approved by the prosecutors coordinators training 28 |
|---|
| 522 | + | council as the standard utilized by prosecuting attorneys 29 |
|---|
| 523 | + | and circuit attorney; [and] 30 |
|---|
| 524 | + | (7) The development and approval of the form and 31 |
|---|
| 525 | + | uniform manner utilizing the automated case management 32 |
|---|
| 526 | + | system in which all r eferrals required by section 43.503 33 |
|---|
| 527 | + | will be submitted by any law enforcement agency to offices 34 |
|---|
| 528 | + | of a prosecuting attorney or circuit attorney; and 35 |
|---|
| 529 | + | (8) The provision of other assistance to prosecuting 36 |
|---|
| 530 | + | attorneys and circuit attorney that is necessary for the 37 |
|---|
| 531 | + | successful implementation of sections 56.750 to 56.775 , 38 |
|---|
| 532 | + | including members of the Missouri office of prosecution 39 |
|---|
| 533 | + | services serving as special prosecuting attorneys and 40 |
|---|
| 534 | + | special assistant prosecuting attorneys, or that hereinafter 41 |
|---|
| 535 | + | may be authorized by law. 42 |
|---|
| 536 | + | 2. Beginning March 31, 2028, and by March thirty -first 43 |
|---|
| 537 | + | of each year thereafter, the Missouri office of prosecution 44 |
|---|
| 538 | + | services shall compile a statewide report summarizing from 45 |
|---|
| 539 | + | the automated case management system, approved by the 46 |
|---|
| 540 | + | prosecutors coordinators training council as provided in 47 |
|---|
| 541 | + | subdivision (6) of subsection 1 of this section for all 48 |
|---|
| 542 | + | offices of prosecuting or circuit attorneys, for the 49 |
|---|
| 543 | + | previous calendar year the following information: 50 |
|---|
| 544 | + | 17 |
|---|
| 545 | + | (1) The total number of felonies, misd emeanors, and 51 |
|---|
| 546 | + | infractions received by all offices of prosecuting and 52 |
|---|
| 547 | + | circuit attorneys, including: 53 |
|---|
| 548 | + | (a) The number of all referrals received from law 54 |
|---|
| 549 | + | enforcement; 55 |
|---|
| 550 | + | (b) The number of all cases filed; 56 |
|---|
| 551 | + | (c) The number of all cases refused; 57 |
|---|
| 552 | + | (d) The number of all cases disposed; and 58 |
|---|
| 553 | + | (e) The number of all cases under review on December 59 |
|---|
| 554 | + | thirty-first of the calendar year being reported; 60 |
|---|
| 555 | + | (2) Any information specific to felonies, 61 |
|---|
| 556 | + | misdemeanors, and infractions received by all offi ces of 62 |
|---|
| 557 | + | prosecuting and circuit attorneys, including: 63 |
|---|
| 558 | + | (a) The number of referrals received wherein the most 64 |
|---|
| 559 | + | serious charge was a felony; 65 |
|---|
| 560 | + | (b) The number of referrals received wherein the most 66 |
|---|
| 561 | + | serious charge was a misdemeanor; 67 |
|---|
| 562 | + | (c) The number of referrals received wherein the most 68 |
|---|
| 563 | + | serious charge was an infraction; 69 |
|---|
| 564 | + | (d) The number of referrals with all charges refused 70 |
|---|
| 565 | + | where in the most serious charge referred was a felony; 71 |
|---|
| 566 | + | (e) The number of referrals with all charges refused 72 |
|---|
| 567 | + | wherein the most serious charge referred was a misdemeanor; 73 |
|---|
| 568 | + | (f) The number of referrals with all charges refused 74 |
|---|
| 569 | + | wherein the most serious charge referred was an infraction; 75 |
|---|
| 570 | + | (g) The number of cases filed where in the most 76 |
|---|
| 571 | + | serious charge was a fe lony; 77 |
|---|
| 572 | + | (h) The number of cases filed wherein the most serious 78 |
|---|
| 573 | + | charge was a misdemeanor; 79 |
|---|
| 574 | + | (i) The number of cases filed wherein the most serious 80 |
|---|
| 575 | + | charge was an infraction; 81 |
|---|
| 576 | + | (j) The number of cases disposed wherein the most 82 |
|---|
| 577 | + | serious charge was a felony; 83 |
|---|
| 578 | + | 18 |
|---|
| 579 | + | (k) The number of cases disposed wherein the most 84 |
|---|
| 580 | + | serious charge was a misdemeanor; and 85 |
|---|
| 581 | + | (l) The number of cases disposed wherein the most 86 |
|---|
| 582 | + | serious charge was an infraction; 87 |
|---|
| 583 | + | (3) All felonies, misdemeanors, and infractions 88 |
|---|
| 584 | + | received by all offices of prosecuting and circuit attorneys 89 |
|---|
| 585 | + | by specific statute number and charge code, including: 90 |
|---|
| 586 | + | (a) All charges received in referrals by statute 91 |
|---|
| 587 | + | number and charge code; 92 |
|---|
| 588 | + | (b) All charges filed by statute number and charge 93 |
|---|
| 589 | + | code; 94 |
|---|
| 590 | + | (c) All charges refused by statute number and charge 95 |
|---|
| 591 | + | code; 96 |
|---|
| 592 | + | (d) All charges disposed by statute number and charge 97 |
|---|
| 593 | + | code; and 98 |
|---|
| 594 | + | (e) All charges under review on December thirty -first 99 |
|---|
| 595 | + | of the calendar year being reported by statute number an d 100 |
|---|
| 596 | + | charge code; and 101 |
|---|
| 597 | + | (4) Each case in which an informant, as such term is 102 |
|---|
| 598 | + | defined by section 491.065, has been endorsed by the state 103 |
|---|
| 599 | + | to testify against a defendant's interest including: 104 |
|---|
| 600 | + | (a) The substance of the testimony; and 105 |
|---|
| 601 | + | (b) Any benefit that has been requested by or has been 106 |
|---|
| 602 | + | offered to the informant as defined in section 491.065, and 107 |
|---|
| 603 | + | any benefit that may be provided at a future date in 108 |
|---|
| 604 | + | connection with such testimony. 109 |
|---|
| 605 | + | 3. Any information provided under subdivisions (1) to 110 |
|---|
| 606 | + | (4) of subsection 2 of this section shall be compiled for 111 |
|---|
| 607 | + | each individual office of a prosecuting or circuit 112 |
|---|
| 608 | + | attorney. The summary reports shall be considered a public 113 |
|---|
| 609 | + | record. The individual data and information compiled by and 114 |
|---|
| 610 | + | received from each office of a prosecuting or circuit 115 |
|---|
| 611 | + | 19 |
|---|
| 612 | + | attorney is confidential and shall be a closed record and 116 |
|---|
| 613 | + | not subject to release under section 610.100. 117 |
|---|
| 614 | + | 4. Any information provided under subdivision (4) of 118 |
|---|
| 615 | + | subsection 2 of this section is accessible by the 119 |
|---|
| 616 | + | prosecuting or circuit attorney or by any attorney who has 120 |
|---|
| 617 | + | entered an appearance on behalf of a party to the case in 121 |
|---|
| 618 | + | which the informant is an endorsed witness. 122 |
|---|
| 619 | + | 57.010. 1. At the general election to be held in 1 |
|---|
| 620 | + | 1948, and at each general elec tion held every four years 2 |
|---|
| 621 | + | thereafter, the voters in every county in this state shall 3 |
|---|
| 622 | + | elect some suitable person sheriff. No person shall be 4 |
|---|
| 623 | + | eligible for the office of sheriff who has been convicted of 5 |
|---|
| 624 | + | a felony. Such person shall be a resident taxpay er and 6 |
|---|
| 625 | + | elector of said county, shall have resided in said county 7 |
|---|
| 626 | + | for more than one whole year next before filing for said 8 |
|---|
| 627 | + | office and shall be a person capable of efficient law 9 |
|---|
| 628 | + | enforcement. When any person shall be elected sheriff, such 10 |
|---|
| 629 | + | person shall enter upon the discharge of the duties of such 11 |
|---|
| 630 | + | person's office as chief law enforcement officer of that 12 |
|---|
| 631 | + | county on the first day of January next succeeding said 13 |
|---|
| 632 | + | election. 14 |
|---|
| 633 | + | 2. No person shall be eligible for the office of 15 |
|---|
| 634 | + | sheriff who does not hold a valid peace officer license 16 |
|---|
| 635 | + | pursuant to chapter 590. Any person filing for the office 17 |
|---|
| 636 | + | of sheriff shall have a valid peace officer license at the 18 |
|---|
| 637 | + | time of filing for office. This subsection shall not apply 19 |
|---|
| 638 | + | to the sheriff of any county of the first clas sification 20 |
|---|
| 639 | + | with a charter form of government with a population over 21 |
|---|
| 640 | + | nine hundred thousand or of any city not within a county. 22 |
|---|
| 641 | + | 3. The sheriff of any city not within a county shall 23 |
|---|
| 642 | + | be required to hold a valid peace officer license pursuant 24 |
|---|
| 643 | + | to chapter 590 within two years of being elected as sheriff. 25 |
|---|
| 663 | | - | 37tofundthepoliceforcegovernedbytheboardofpolicecommissioners.Anypension |
|---|
| 664 | | - | 38andretirementcostsshallbeexcludedfromthecalculationofexpensesforthe |
|---|
| 665 | | - | 39maintenanceofthepoliceforceforthepurposesoftheminimumfundingrequirements |
|---|
| 666 | | - | 40providedinthissubsection. |
|---|
| 667 | | - | 41 4.Notwithstandingtheprovisionsofsubsection1ofthissectiontothecontrary,the |
|---|
| 668 | | - | 42boardofpolicecommissionersshallpayadditionalcompensationforallhoursofservice |
|---|
| 669 | | - | 43renderedbyprobationarypatrolmen[and],patrolmen, andsergeantsinexcessofthe |
|---|
| 670 | | - | 44establishedregularworkingperiod,andtherateofcompensationshallbeoneandone-half |
|---|
| 671 | | - | 45timestheregularhourlyrateofpaytowhicheachmembershallnormallybeentitled;except |
|---|
| 672 | | - | 46that,thecourttimeandcourtstandbytimeshallbepaidattheregularhourlyrateofpayto |
|---|
| 673 | | - | 47whicheachmembershallnormallybeentitled.Nocreditshallbegivenordeductionsmade |
|---|
| 674 | | - | 48frompaymentsforovertimeforthepurposeofretirementbenefits. |
|---|
| 675 | | - | 49 5.Notwithstandingtheprovisionsofsubsection1ofthissectiontothecontrary, |
|---|
| 676 | | - | 50probationarypatrolmen[and], patrolmen, andsergeantsshallreceiveadditional |
|---|
| 677 | | - | 51compensationforauthorizedovertime,courttimeandcourtstandbytimewheneverthe |
|---|
| 678 | | - | 52totalaccumulatedtimeexceedsfortyhours.Theaccumulatedfortyhoursshallbetakenas |
|---|
| 679 | | - | 53compensatorytimeoffattheofficer'sdiscretionwiththeapprovalofhissupervisor. |
|---|
| 680 | | - | 54 6.Theallowanceofcompensationorcompensatorytimeoffforcourtstandbytime |
|---|
| 681 | | - | 55shallbecomputedattherateofone-thirdofonehourforeachhourspentoncourtstandby |
|---|
| 682 | | - | 56time. |
|---|
| 683 | | - | 57 7.Theboardofpolicecommissioners[may] shalleffectprogramstoprovide |
|---|
| 684 | | - | 58additionalcompensationtoitsemployeesforsuccessfulcompletionofacademicworkatan |
|---|
| 685 | | - | 59accreditedcollegeoruniversity,inamountsnottoexceedtenpercentoftheiryearlysalaries |
|---|
| 686 | | - | 60orforfieldtrainingofficerandleadofficerresponsibilitiesinamountsnottoexceedthree |
|---|
| 687 | | - | 61percentoftheiryearlysalariesforfieldtrainingofficerresponsibilitiesandanadditionalthree |
|---|
| 688 | | - | 62percentoftheiryearlysalariesforleadofficerresponsibilities.Theboardmaydesignateup |
|---|
| 689 | | - | 63toonehundredfiftyemployeesasfieldtrainingofficersanduptofiftyemployeesaslead |
|---|
| 690 | | - | 64officers. |
|---|
| 691 | | - | 65 8.Theboardofpolicecommissioners: |
|---|
| 692 | | - | 66 (1)Shallprovideorcontractforlifeinsurancecoverageandforinsurancebenefits |
|---|
| 693 | | - | 67providinghealth,medicalanddisabilitycoverageforofficersandemployeesofthe |
|---|
| 694 | | - | 68department; |
|---|
| 695 | | - | SS#2SCSHCS#2HB495 19 69 (2)Shallprovideorcontractforinsurancecoverageprovidingsalarycontinuation |
|---|
| 696 | | - | 70coverageforofficersandemployeesofthepolicedepartment; |
|---|
| 697 | | - | 71 (3)Shallprovidehealth,medical,andlifeinsurancecoverageforretiredofficersand |
|---|
| 698 | | - | 72employeesofthepolicedepartment.Health,medicalandlifeinsurancecoverageshallbe |
|---|
| 699 | | - | 73madeavailableforpurchasetothespousesordependentsofdeceasedretiredofficersand |
|---|
| 700 | | - | 74employeesofthepolicedepartmentwhoreceivepensionbenefitspursuanttosections86.200 |
|---|
| 701 | | - | 75to86.364attheratethatsuchdependent'sorspouse'scoveragewouldcostunderthe |
|---|
| 702 | | - | 76appropriateplanifthedeceasedwereliving; |
|---|
| 703 | | - | 77 (4)Maypayanadditionalshiftdifferentialcompensationtomembersofthepolice |
|---|
| 704 | | - | 78forceforeveningandnighttourofdutyinanamountnottoexceedtenpercentoftheofficer's |
|---|
| 705 | | - | 79basehourlyrate. |
|---|
| 706 | | - | 80 9.Notwithstandingtheprovisionsofsubsection1ofthissectiontothecontrary,the |
|---|
| 707 | | - | 81boardofpolicecommissionersshallpayadditionalcompensationtomembersofthepolice |
|---|
| 708 | | - | 82forceuptoandincludingtherankofpoliceofficerforanyfullhourworkedbetweenthe |
|---|
| 709 | | - | 83hoursof11:00p.m.and7:00a.m.,inamountsequalto[five]tenpercentoftheofficer'sbase |
|---|
| 710 | | - | 84hourlypay. |
|---|
| 711 | | - | 85 10.Theboardofpolicecommissioners,fromtimetotimeandinitsdiscretion,may |
|---|
| 712 | | - | 86payadditionalcompensationtopoliceofficers,sergeantsandlieutenantsbypaying |
|---|
| 713 | | - | 87commissionedofficersintheaforesaidranksforaccumulated,unusedvacationtime.Any |
|---|
| 714 | | - | 88suchpaymentsshallbemadeinincrementsofnotlessthanfortyhours,andatrates |
|---|
| 715 | | - | 89equivalenttothebasestraight-timeratesbeingearnedbysaidofficersatthetimeofpayment; |
|---|
| 716 | | - | 90exceptthat,nosuchofficershallberequiredtoacceptpaymentforaccumulatedunused |
|---|
| 717 | | - | 91vacationtime. |
|---|
| 718 | | - | 84.170.1.Whenanyvacancyshalltakeplaceinanygradeofofficers,itshallbe |
|---|
| 719 | | - | 2filledfromthenextlowestgrade;provided,however,thatprobationarypatrolmenshallserve |
|---|
| 720 | | - | 3atleastsixmonthsassuchbeforebeingpromotedtotherankofpatrolman;patrolmenshall |
|---|
| 721 | | - | 4serveatleastthreeyearsassuchbeforebeingpromotedtotherankofsergeant;sergeants |
|---|
| 722 | | - | 5shallserveatleastoneyearassuchbeforebeingpromotedtotherankoflieutenant; |
|---|
| 723 | | - | 6lieutenantsshallserveatleastoneyearassuchbeforebeingpromotedtotherankofcaptain; |
|---|
| 724 | | - | 7andinnocaseshallthechieforassistantchiefbeselectedfrommennotmembersoftheforce |
|---|
| 725 | | - | 8orbelowthegradeofcaptain.Patrolmenshallserveatleastthreeyearsassuchbefore |
|---|
| 726 | | - | 9promotiontotherankofdetective;theinspectorshallbetakenfrommenintheranknot |
|---|
| 727 | | - | 10belowthegradeoflieutenant. |
|---|
| 728 | | - | 11 2.Theboardsofpoliceareherebyauthorizedtomakeallsuchrulesandregulations, |
|---|
| 729 | | - | 12notinconsistentwithsections84.010to84.340,orotherlawsofthestate,astheymayjudge |
|---|
| 730 | | - | 13necessary,fortheappointment,employment,uniforming,discipline,trialandgovernmentof |
|---|
| 731 | | - | 14thepolice.Atthetimeoftheeffectivedateofthisactanduntilsuchtimeastheboard |
|---|
| 732 | | - | SS#2SCSHCS#2HB495 20 15adoptsotherinvestigativeanddisciplinarypoliciesandproceduresnotinconsistentwith |
|---|
| 733 | | - | 16section590.502,disciplineandinvestigativeproceduresforcommissionedandcivilian |
|---|
| 734 | | - | 17employeesofthepoliceforceshallberegulatedbyrule7ofthepolicemanualofthe |
|---|
| 735 | | - | 18policedepartmentineffectasofNovember4,2013;exceptthat,whererule7isin |
|---|
| 736 | | - | 19conflictwithsection590.502,theboardshallcomplywiththerequirementsofsection |
|---|
| 737 | | - | 20590.502.Undernocircumstancesshalltheboardinitiallyorhereafteradopt |
|---|
| 738 | | - | 21investigativeanddisciplinaryproceduresthatdonotincludethesummaryhearing |
|---|
| 739 | | - | 22boardproceduresprovidedforinrule7ofthepolicemanualofthepolicedepartmentin |
|---|
| 740 | | - | 23effectasofNovember4,2013.Thesaidboardsshallalsohavepowertorequireofany |
|---|
| 741 | | - | 24officerorpolicemanbondwithsuretieswhentheymayconsideritdemandedbythepublic |
|---|
| 742 | | - | 25interests.Alllawfulrulesandregulationsoftheboardshallbeobeyedbythepoliceforceon |
|---|
| 743 | | - | 26painofdismissalorsuchlighterpunishment,eitherbysuspension,fine,reductionor |
|---|
| 744 | | - | 27forfeitureofpay,orotherwiseastheboardsmayadjudge. |
|---|
| 745 | | - | 28 3.Theauthoritypossessedbytheboardofpoliceincludes,butisnotlimitedto,the |
|---|
| 746 | | - | 29authoritytodelegateportionsofitspowersauthorizedinsection84.120,includingpresiding |
|---|
| 747 | | - | 30overadisciplinaryhearing,toahearingofficerasdeterminedbytheboard. |
|---|
| 748 | | - | 84.225.Anyofficerorservantofthemayororcommoncouncilormunicipal |
|---|
| 749 | | - | 2assemblyofthecities,orotherpersonswhatsoever,whoforciblyresistsorobstructsthe |
|---|
| 750 | | - | 3executionorenforcementofanyoftheprovisionsofsections84.012to84.340orrelating |
|---|
| 751 | | - | 4tothesame,orwhodisbursesorfailstodisburseanymoneyinviolationthereof,orwho |
|---|
| 752 | | - | 5hindersorobstructstheorganizationormaintenanceoftheboardofpolice |
|---|
| 753 | | - | 6commissionersorthepoliceforcethereinprovidedtobeorganizedandmaintained, |
|---|
| 754 | | - | 7orwhomaintainsorcontrolsanypoliceforceotherthantheonethereinprovidedfor,or |
|---|
| 755 | | - | 8whodelaysorhindersthedueenforcementofsections84.012to84.340byfailingor |
|---|
| 756 | | - | 9neglectingtoperformthedutiesbysuchsectionsimposeduponhimorher,shallbe |
|---|
| 757 | | - | 10subjecttoapenaltyofonethousanddollarsforeachoffense,recoverablebytheboard |
|---|
| 758 | | - | 11byactionatlawinthenameofthestate,andshallforeverthereafterbedisqualified |
|---|
| 759 | | - | 12fromholdingorexercisinganyofficeoremploymentwhatsoeverunderthemayoror |
|---|
| 760 | | - | 13commoncouncilormunicipalassemblyofsuchcities,orundersections84.012to |
|---|
| 761 | | - | 1484.340;providedthat,nothinginthissectionshallbeconstruedtointerferewiththe |
|---|
| 762 | | - | 15punishment,underanyexistingoranyfuturelawsofthisstate,ofanycriminaloffense |
|---|
| 763 | | - | 16thatiscommittedbythepartiesinorabouttheresistance,obstruction,hindrance, |
|---|
| 764 | | - | 17conspiracy,combination,ordisbursementaforesaid. |
|---|
| 765 | | - | 84.325.1.Atransitiondirectorshallbeappointedbythegovernortoensure |
|---|
| 766 | | - | 2oversightofanorderlytransitionofthecontrolofanymunicipalpoliceforcefromany |
|---|
| 767 | | - | 3citynotwithinacountytotheboardofpolicecommissioners.Theimplementation |
|---|
| 768 | | - | 4periodshallbeginontheeffectivedateofthisact,andendnolaterthanJuly1,2026. |
|---|
| 769 | | - | SS#2SCSHCS#2HB495 21 5Theboardofpolicecommissionersshallassumecontrolofanymunicipalpoliceforce |
|---|
| 770 | | - | 6establishedwithinanycitynotwithinacountyduringtheimplementationperiod, |
|---|
| 771 | | - | 7accordingtotheproceduresandrequirementsofthissectionandanyrulespromulgated |
|---|
| 772 | | - | 8undersubsection6ofthissectionandasdeterminedincoordinationwiththetransition |
|---|
| 773 | | - | 9director,localofficials,andtheboardofpolicecommissioners.Thepurposeofthese |
|---|
| 774 | | - | 10proceduresandrequirementsistoensurethecontinuityofoperationsofthemunicipal |
|---|
| 775 | | - | 11policeforcewithminimizeddisruptionstotheresidentsofanycitynotwithinacounty, |
|---|
| 776 | | - | 12toprovideforanorderlyandappropriatetransitioninthegovernanceofthepolice |
|---|
| 777 | | - | 13force,andtoprovideforanequitableemploymenttransitionforcommissionedand |
|---|
| 778 | | - | 14civilianpersonnel. |
|---|
| 779 | | - | 15 2.Upontheassumptionofcontrolbytheboardofpolicecommissionersunder |
|---|
| 780 | | - | 16subsection1ofthissection,anymunicipalpolicedepartmentwithinanycitynotwithin |
|---|
| 781 | | - | 17acountyshallconvey,assign,andotherwisetransfertotheboardtitleandownershipof |
|---|
| 782 | | - | 18allindebtednessandassets,including,butnotlimitedto,allfundsandrealandpersonal |
|---|
| 783 | | - | 19propertyheldinthenameoforcontrolledbythemunicipalpolicedepartment.Such |
|---|
| 784 | | - | 20cityshallthereafterceasetheoperationofanypolicedepartmentorpoliceforce. |
|---|
| 785 | | - | 21 3.Upontheassumptionofcontrolbytheboardofpolicecommissionersunder |
|---|
| 786 | | - | 22subsection1ofthissection,thestateshallacceptresponsibility,ownership,andliability |
|---|
| 787 | | - | 23assuccessor-in-interestforcontractualobligationsandotherlawfulobligationsofthe |
|---|
| 788 | | - | 24municipalpolicedepartment. |
|---|
| 789 | | - | 25 4.Theboardofpolicecommissionersshallinitiallyemploy,withoutareduction |
|---|
| 790 | | - | 26inrank,salary,orbenefits,allcommissionedandcivilianpersonnelofthemunicipal |
|---|
| 791 | | - | 27policedepartmentwhowereemployedbythemunicipalpolicedepartmentimmediately |
|---|
| 792 | | - | 28priortothedatetheboardassumedcontrol.Theboardshallrecognizeallaccrued |
|---|
| 793 | | - | 29yearsofservicethatsuchcommissionedandcivilianpersonnelhadwiththemunicipal |
|---|
| 794 | | - | 30policedepartment,aswellasallaccruedyearsofservicethatsuchcommissionedand |
|---|
| 795 | | - | 31civilianpersonnelhadpreviouslywiththeboardofpolicecommissioners.Such |
|---|
| 796 | | - | 32personnelshallbeentitledtothesameholidays,vacation,sickleave,sickbonustime, |
|---|
| 797 | | - | 33andannualstep-increasestheywereentitledtoasemployeesofthemunicipalpolice |
|---|
| 798 | | - | 34department. |
|---|
| 799 | | - | 35 5.Thecommissionedandcivilianpersonnelwhoretirefromservicewiththe |
|---|
| 800 | | - | 36municipalpolicedepartmentbeforetheboardofpolicecommissionersassumedcontrol |
|---|
| 801 | | - | 37ofthedepartmentundersubsection1ofthissectionshallcontinuetobeentitledtothe |
|---|
| 802 | | - | 38samepensionbenefitsprovidedasemployeesofthemunicipalpolicedepartmentand |
|---|
| 803 | | - | 39thesamebenefitssetforthinsubsection4ofthissection.Anypolicepensionsystem |
|---|
| 804 | | - | 40createdunderchapter86forthebenefitofapoliceforceestablishedundersections |
|---|
| 805 | | - | 4184.012to84.340shallcontinuetobegovernedbychapter86andshallapplytoany |
|---|
| 806 | | - | SS#2SCSHCS#2HB495 22 42comprehensivepolicingplanandanypoliceforceestablishedundersections84.012to |
|---|
| 807 | | - | 4384.340.Otherthananyprovisionthatmakeschapter86applicabletoamunicipal |
|---|
| 808 | | - | 44policeforceestablishedundersections84.343to84.346,nothinginsections84.012to |
|---|
| 809 | | - | 4584.340shallbeconstruedaslimitingorchangingtherightsorbenefitsprovidedunder |
|---|
| 810 | | - | 46chapter86. |
|---|
| 811 | | - | 47 6.Theboardofpolicecommissionersmaypromulgateallnecessaryrulesand |
|---|
| 812 | | - | 48regulationsfortheimplementationandadministrationofthissection.Anyruleor |
|---|
| 813 | | - | 49portionofarule,asthattermisdefinedinsection536.010,thatiscreatedunderthe |
|---|
| 814 | | - | 50authoritydelegatedinthissectionshallbecomeeffectiveonlyifitcomplieswithandis |
|---|
| 815 | | - | 51subjecttoalloftheprovisionsofchapter536and,ifapplicable,section536.028.This |
|---|
| 816 | | - | 52sectionandchapter536arenonseverableandifanyofthepowersvestedwiththe |
|---|
| 817 | | - | 53generalassemblypursuanttochapter536toreview,todelaytheeffectivedate,orto |
|---|
| 818 | | - | 54disapproveandannularulearesubsequentlyheldunconstitutional,thenthegrantof |
|---|
| 819 | | - | 55rulemakingauthorityandanyruleproposedoradoptedaftertheeffectivedateofthis |
|---|
| 820 | | - | 56sectionshallbeinvalidandvoid. |
|---|
| 821 | | - | 105.726.1.Nothinginsections105.711to105.726shallbeconstruedtobroadenthe |
|---|
| 822 | | - | 2liabilityofthestateofMissouribeyondtheprovisionsofsections537.600to537.610,norto |
|---|
| 823 | | - | 3abolishorwaiveanydefenseatlawwhichmightotherwisebeavailabletoanyagency, |
|---|
| 824 | | - | 4officer,oremployeeofthestateofMissouri.Sections105.711to105.726donotwaivethe |
|---|
| 825 | | - | 5sovereignimmunityofthestateofMissouri. |
|---|
| 826 | | - | 6 2.Thecreationofthestatelegalexpensefundandthepaymenttherefromofsuch |
|---|
| 827 | | - | 7amountsasmaybenecessaryforthebenefitofanypersoncoveredtherebyaredeemed |
|---|
| 828 | | - | 8necessaryandproperpublicpurposesforwhichfundsofthisstatemaybeexpended. |
|---|
| 829 | | - | 9 3.Moneysinthestatelegalexpensefundshallnotbeavailableforthepaymentof |
|---|
| 830 | | - | 10anyclaimoranyamountrequiredbyanyfinaljudgmentrenderedbyacourtofcompetent |
|---|
| 831 | | - | 11jurisdictionagainstaboardofpolicecommissionersestablishedunderchapter84,including |
|---|
| 832 | | - | 12thecommissioners,anypoliceofficer,notwithstandingsections84.330and84.710,orother |
|---|
| 833 | | - | 13provisionsoflaw,otheremployees,agents,representative,oranyotherindividualorentity |
|---|
| 834 | | - | 14actingorpurportingtoactonitsortheirbehalf.Suchwastheintentofthegeneralassembly |
|---|
| 835 | | - | 15intheoriginalenactmentofsections105.711to105.726,anditismadeexpressbythis |
|---|
| 836 | | - | 16sectioninlightofthedecisioninWaymanSmith,III,etal.v.StateofMissouri,152S.W.3d |
|---|
| 837 | | - | 17275.Exceptthatthecommissionerofadministrationshallreimbursefromthelegalexpense |
|---|
| 838 | | - | 18fundthe[board] boardsofpolicecommissionersestablishedunder[section84.350,andany |
|---|
| 839 | | - | 19successor-in-interestestablishedpursuanttosection84.344,] chapter84forliabilityclaims |
|---|
| 840 | | - | 20otherwiseeligibleforpaymentundersection105.711paidbysuch[board] boardsonan |
|---|
| 841 | | - | 21equalsharebasisperclaimuptoamaximumof[one]twomilliondollarsperfiscalyear. |
|---|
| 842 | | - | SS#2SCSHCS#2HB495 23 22 4.[Subjecttotheprovisionsofsubsection2ofsection84.345,] Iftherepresentation |
|---|
| 843 | | - | 23oftheattorneygeneralisrequestedbyaboardofpolicecommissioners[oritssuccessor-in- |
|---|
| 844 | | - | 24interestestablishedpursuanttosection84.344], theattorneygeneralshallrepresent, |
|---|
| 845 | | - | 25investigate,defend,negotiate,orcompromiseallclaimsundersections105.711to105.726 |
|---|
| 846 | | - | 26fortheboardofpolicecommissioners,[itssuccessor-in-interestpursuanttosection84.344,] |
|---|
| 847 | | - | 27anypoliceofficer,otheremployees,agents,representatives,oranyotherindividualorentity |
|---|
| 848 | | - | 28actingorpurportingtoactontheirbehalf.Theattorneygeneralmayestablishproceduresby |
|---|
| 849 | | - | 29rulespromulgatedunderchapter536underwhichclaimsmustbereferredfortheattorney |
|---|
| 850 | | - | 30general'srepresentation.Theattorneygeneralandtheofficialsofthecitywhichthepolice |
|---|
| 851 | | - | 31boardrepresents[orrepresented] shallmeetandnegotiatereasonableexpensesorchargesthat |
|---|
| 852 | | - | 32willfairlycompensatetheattorneygeneralandtheofficeofadministrationforthecostofthe |
|---|
| 853 | | - | 33representationoftheclaimsunderthissection. |
|---|
| 854 | | - | 34 5.Claimstenderedtotheattorneygeneralpromptlyaftertheclaimwasassertedas |
|---|
| 855 | | - | 35requiredbysection105.716andpriortoAugust28,2005,maybeinvestigated,defended, |
|---|
| 856 | | - | 36negotiated,orcompromisedbytheattorneygeneralandfullpaymentsmaybemadefromthe |
|---|
| 857 | | - | 37statelegalexpensefundonbehalfoftheentitiesandindividualsdescribedinthissectionasa |
|---|
| 858 | | - | 38resultoftheholdinginWaymanSmith,III,etal.v.StateofMissouri,152S.W.3d275. |
|---|
| 859 | | - | 191.1005.1.Noindividualorentityshallknowinglyopen,lease,rent,own,use, |
|---|
| 860 | | - | 2maintain,manage,operate,orcontrolapublicorprivatefacility,site,orbuildingforthe |
|---|
| 861 | | - | 3purpose,inpartorinwhole,ofallowingindividualstoself-administerpreobtained |
|---|
| 862 | | - | 4controlledsubstances,thepossessionofwhichbytheindividualispunishableunder |
|---|
| 863 | | - | 5section579.015andisnototherwiseauthorizedbychapters195and579. |
|---|
| 864 | | - | 6 2.Thissectionshallnotapplytoanyhealthcarefacilitylicensedpursuantto |
|---|
| 865 | | - | 7chapter197or198that: |
|---|
| 866 | | - | 8 (a)Providesmedicalassistanceormonitoringtoindividualswhohaveself- |
|---|
| 867 | | - | 9administeredcontrolledsubstances; |
|---|
| 868 | | - | 10 (b)Providessterileinjectionsupplies; |
|---|
| 869 | | - | 11 (c)Collectsusedhypodermicneedlesandsyringes;or |
|---|
| 870 | | - | 12 (d)Providessecurehypodermicneedleandsyringedisposalservices. |
|---|
| 871 | | - | 13 3.Thissectionshallnotaffecttheimmunityfromliabilityprovidedbysection |
|---|
| 872 | | - | 14195.205foranyindividualwho,ingoodfaith,seeksorobtainsmedicalassistancefor |
|---|
| 873 | | - | 15someonewhoisexperiencinganoverdoseofacontrolledsubstanceorforanyindividual |
|---|
| 874 | | - | 16experiencinganoverdoseofacontrolledsubstancewhoseeksmedicalassistancefor |
|---|
| 875 | | - | 17himselforherselforisthesubjectofagoodfaithrequestformedicalassistanceforan |
|---|
| 876 | | - | 18overdoseofacontrolledsubstance. |
|---|
| 877 | | - | 19 4.Asusedinthissection,theterm"controlledsubstance"meansadrug, |
|---|
| 878 | | - | 20substance,orimmediateprecursorinSchedulesIthroughVlistedinchapter195. |
|---|
| 879 | | - | SS#2SCSHCS#2HB495 24 217.451.Nocorrectionalcenterorotherpartyshallchargeanoffenderina |
|---|
| 880 | | - | 2correctionalcenteratotalamountforadomesticphonecall,includingfeesandanyper- |
|---|
| 881 | | - | 3minuterate,thatexceedstheequivalentoftwelvecentsperminute. |
|---|
| 882 | | - | 221.108.1.Jailsshallprovideinmateswithreasonableaccesstophoneservices |
|---|
| 883 | | - | 2duringaninmate'stermofconfinement,exceptphoneaccessmayberestrictedasa |
|---|
| 884 | | - | 3disciplinarymeasure. |
|---|
| 885 | | - | 4 2.Nojailorotherpartyshallchargeaninmateinajailatotalamountfora |
|---|
| 886 | | - | 5domesticphonecall,includingfeesandanyper-minuterate,thatexceedstheequivalent |
|---|
| 887 | | - | 6oftwelvecentsperminute. |
|---|
| 888 | | - | 221.520.1.Asusedinthissection,thefollowingtermsmean: |
|---|
| 889 | | - | 2 (1)"Extraordinarycircumstance",asubstantialflightriskorsomeother |
|---|
| 890 | | - | 3extraordinarymedicalorsecuritycircumstancethatdictatesrestraintsbeusedto |
|---|
| 891 | | - | 4ensurethesafetyandsecurityofapregnantoffenderinherthirdtrimesterora |
|---|
| 892 | | - | 5postpartumoffenderwithinforty-eighthourspostdelivery,thestaffofthecountyorcity |
|---|
| 893 | | - | 6jailormedicalfacility,otheroffenders,orthepublic; |
|---|
| 894 | | - | 7 (2)"Labor",theperiodoftimebeforeabirthduringwhichcontractionsare |
|---|
| 895 | | - | 8present; |
|---|
| 896 | | - | 9 (3)"Postpartum",theperiodofrecoveryimmediatelyfollowingchildbirth, |
|---|
| 897 | | - | 10whichissixweeksforavaginalbirthoreightweeksforacesareanbirth,orlongerifso |
|---|
| 898 | | - | 11determinedbyaphysicianornurse; |
|---|
| 899 | | - | 12 (4)"Restraints",anydeviceusedtocontrolthemovementofaperson'sbodyor |
|---|
| 900 | | - | 13limbs. |
|---|
| 901 | | - | 14 2.Exceptinextraordinarycircumstances,acountyorcityjailshallnotuse |
|---|
| 902 | | - | 15restraintsonapregnantoffenderinherthirdtrimester,whetherduringtransportation |
|---|
| 903 | | - | 16toandfromvisitstohealthcareprovidersandcourtproceedings,duringmedical |
|---|
| 904 | | - | 17appointmentsandexaminations,orduringlabor,delivery,orforty-eighthours |
|---|
| 905 | | - | 18postdelivery. |
|---|
| 906 | | - | 19 3.Pregnantoffendersshallbetransportedinvehiclesequippedwithseatbelts. |
|---|
| 907 | | - | 20 4.Intheeventasherifforjailerdeterminesthatextraordinarycircumstances |
|---|
| 908 | | - | 21existandrestraintsarenecessary,thesherifforjailershallfullydocumentinwriting |
|---|
| 909 | | - | 22withinforty-eighthoursoftheincidentthereasonsheorshedeterminedsuch |
|---|
| 910 | | - | 23extraordinarycircumstancesexisted,thetypeofrestraintsused,andthereasonsthose |
|---|
| 911 | | - | 24restraintswereconsideredreasonableunderthecircumstances.Suchdocumentsshall |
|---|
| 912 | | - | 25bekeptonfilebythecountyorcityjailforatleastfiveyearsfromthedatetherestraints |
|---|
| 913 | | - | 26wereused. |
|---|
| 914 | | - | 27 5.Anytimerestraintsareusedonapregnantoffenderinherthirdtrimesteror |
|---|
| 915 | | - | 28onapostpartumoffenderwithinforty-eighthourspostdelivery,therestraintsshallbe |
|---|
| 916 | | - | SS#2SCSHCS#2HB495 25 29reasonableunderthecircumstances.Exceptinextraordinarycircumstances,noleg, |
|---|
| 917 | | - | 30ankle,orwaistrestraintsoranymechanicalrestraintsshallbeusedonanysuch |
|---|
| 918 | | - | 31offender,and,ifwristrestraintsareused,suchrestraintsshallbeplacedinthefrontof |
|---|
| 919 | | - | 32suchoffender'sbodytoprotecttheoffenderandtheunbornchildinthecaseofa |
|---|
| 920 | | - | 33forwardfall. |
|---|
| 921 | | - | 34 6.Thecountyorcityjailshall: |
|---|
| 922 | | - | 35 (1)Ensurethatemployeesofthejailareprovidedwithtraining,whichmay |
|---|
| 923 | | - | 36includeonlinetraining,ontheprovisionsofthissection;and |
|---|
| 924 | | - | 37 (2)Informfemaleoffenders,inwritingandorally,ofanypoliciesandpractices |
|---|
| 925 | | - | 38developedinaccordancewiththissectionuponadmissiontothejail,andpostthe |
|---|
| 926 | | - | 39policiesandpracticesinlocationsinthejailwheresuchnoticesarecommonlyposted |
|---|
| 927 | | - | 40andwillbeseenbyfemaleoffenders. |
|---|
| 928 | | - | 221.523.1.ByJanuary1,2026,allcountyandcityjailsshalldevelopspecific |
|---|
| 929 | | - | 2proceduresfortheintakeandcareofoffenderswhoarepregnant,whichshallinclude |
|---|
| 930 | | - | 3proceduresregarding: |
|---|
| 931 | | - | 4 (1)Maternalhealthevaluations; |
|---|
| 932 | | - | 5 (2)Dietarysupplements,includingprenatalvitamins; |
|---|
| 933 | | - | 6 (3)Timelyandregularnutritiousmeals,consistentwiththeNutritionDuring |
|---|
| 934 | | - | 7PregnancyGuidelinespreparedbytheAmericanCollegeofObstetriciansand |
|---|
| 935 | | - | 8Gynecologists; |
|---|
| 936 | | - | 9 (4)Substanceabusetreatment; |
|---|
| 937 | | - | 10 (5)Treatmentforthehumanimmunodeficiencyvirusandwaystoavoidhuman |
|---|
| 938 | | - | 11immunodeficiencyvirustransmission; |
|---|
| 939 | | - | 12 (6)HepatitisC; |
|---|
| 940 | | - | 13 (7)Sleepingarrangementsforsuchpregnantoffendersinthethirdtrimester, |
|---|
| 941 | | - | 14includingrequiringsuchoffenderstosleeponthebottombunkbed; |
|---|
| 942 | | - | 15 (8)Accesstomentalhealthprofessionals; |
|---|
| 943 | | - | 16 (9)Sanitarymaterials;and |
|---|
| 944 | | - | 17 (10)Postpartumrecovery,includingthat,exceptinextraordinary |
|---|
| 945 | | - | 18circumstances,nosuchoffendershallbeplacedinisolationduringsuchrecovery. |
|---|
| 946 | | - | 19 2.Asusedinthissection,theterm"postpartumrecovery"means,asdetermined |
|---|
| 947 | | - | 20byaphysician,theperiodimmediatelyfollowingdelivery,includingtheentireperiodan |
|---|
| 948 | | - | 21offenderwhowaspregnantisinthehospitalorinfirmaryafterdelivery. |
|---|
| 949 | | - | 304.012.1.Everypersonoperatingamotorvehicleontheroadsandhighwaysofthis |
|---|
| 950 | | - | 2stateshalldrivethevehicleinacarefulandprudentmannerandatarateofspeedsoasnotto |
|---|
| 951 | | - | 3endangerthepropertyofanotherorthelifeorlimbofanypersonandshallexercisethe |
|---|
| 952 | | - | 4highestdegreeofcare. |
|---|
| 953 | | - | SS#2SCSHCS#2HB495 26 5 2.Nopersonoperatingamotorvehicleontheroadsandhighwaysofthisstate |
|---|
| 954 | | - | 6shallperformstuntdriving,assuchtermisdefinedinsection304.145. |
|---|
| 955 | | - | 7 3.AnypersonwhoviolatestheprovisionsofthissectionisguiltyofaclassB |
|---|
| 956 | | - | 8misdemeanor,unlessanaccidentisinvolvedthenitshallbeaclassAmisdemeanor. |
|---|
| 957 | | - | 304.145.1.Asusedinthissection,thefollowingtermsmean: |
|---|
| 958 | | - | 2 (1)"Aggravatedoffender",apersonwhohasbeenfoundguiltyof: |
|---|
| 959 | | - | 3 (a)Threeormoreviolationsofthissectioncommittedonseparateoccasions;or |
|---|
| 960 | | - | 4 (b)Twoormoreviolationsofthissectioncommittedonseparateoccasionswhere |
|---|
| 961 | | - | 5atleastoneoftheviolationsthedefendantwasoperatingavehicleandanotherperson |
|---|
| 962 | | - | 6wasinjuredorkilled; |
|---|
| 963 | | - | 7 (2)"Burnout",amaneuverperformedwhileoperatingamotorvehiclewhereby |
|---|
| 964 | | - | 8thewheelsofthemotorvehiclearespun,resultinginfrictioncausingthemotorvehicle's |
|---|
| 965 | | - | 9tirestoheatupandemitsmoke; |
|---|
| 966 | | - | 10 (3)"Chronicoffender",apersonwhohasbeenfoundguiltyof: |
|---|
| 967 | | - | 11 (a)Fourormoreviolationsofthissectioncommittedonseparateoccasions;or |
|---|
| 968 | | - | 12 (b)Threeormoreviolationsofthissectioncommittedonseparateoccasions |
|---|
| 969 | | - | 13whereatleastoneoftheviolationsthedefendantwasoperatingavehicleandanother |
|---|
| 970 | | - | 14personwasinjuredorkilled;or |
|---|
| 971 | | - | 15 (c)Twoormoreviolationsofthissectioncommittedonseparateoccasionswhere |
|---|
| 972 | | - | 16bothoftheviolationsthedefendantwasoperatingavehicleandanotherpersonwas |
|---|
| 973 | | - | 17injuredorkilled; |
|---|
| 974 | | - | 18 (4)"Donut",amotorvehiclemaneuverinwhichthefrontorrearofthemotor |
|---|
| 975 | | - | 19vehicleisrotatedaroundtheoppositesetofwheelsinamotionthatmaycauseacurved |
|---|
| 976 | | - | 20skid-markpatternofrubberonthedrivingsurface,orthetirestoheatupandemit |
|---|
| 977 | | - | 21smoke,orboth; |
|---|
| 978 | | - | 22 (5)"Dragrace",theoperationoftwoormoremotorvehiclesfromapointside |
|---|
| 979 | | - | 23bysideinacompetitiveattempttooutgainoroutdistanceeachother,ortheoperationof |
|---|
| 980 | | - | 24oneormoremotorvehiclesoveracommonselectedcourse,forthepurposeof |
|---|
| 981 | | - | 25comparingtherelativespeeds,power,oraccelerationofsuchmotorvehicleswithina |
|---|
| 982 | | - | 26certaindistanceortimelimit; |
|---|
| 983 | | - | 27 (6)"Drifting",amotorvehiclemaneuverinwhichthemotorvehicleissteeredso |
|---|
| 984 | | - | 28thatitmakesacontrolledskidsidewaysthroughaturnwiththefrontwheelsorientedin |
|---|
| 985 | | - | 29adirectionoppositetheturn; |
|---|
| 986 | | - | 30 (7)"Habitualoffender",apersonwhohasbeenfoundguiltyof: |
|---|
| 987 | | - | 31 (a)Fiveormoreviolationsofthissectioncommittedonseparateoccasions; |
|---|
| 988 | | - | SS#2SCSHCS#2HB495 27 32 (b)Fourormoreviolationsofthissectioncommittedonseparateoccasions |
|---|
| 989 | | - | 33whereatleastoneoftheviolationsthedefendantwasoperatingavehicleandanother |
|---|
| 990 | | - | 34personwasinjuredorkilled;or |
|---|
| 991 | | - | 35 (c)Threeormoreviolationsofthissectioncommittedonseparateoccasions |
|---|
| 992 | | - | 36whereatleasttwooftheviolationsthedefendantwasoperatingavehicleandanother |
|---|
| 993 | | - | 37personwasinjuredorkilled; |
|---|
| 994 | | - | 38 (8)"Highway",anypublicthoroughfareforvehicles,includingstateroads, |
|---|
| 995 | | - | 39countyroadsandpublicstreets,avenues,boulevards,parkways,oralleysinany |
|---|
| 996 | | - | 40municipality; |
|---|
| 997 | | - | 41 (9)"Persistentoffender",apersonwhohasbeenfoundguiltyof: |
|---|
| 998 | | - | 42 (a)Twoormoreviolationsofthissectioncommittedonseparateoccasions;or |
|---|
| 999 | | - | 43 (b)Oneviolationofthissectionwherethedefendantwasoperatingavehicleand |
|---|
| 1000 | | - | 44anotherpersonwasinjuredorkilled; |
|---|
| 1001 | | - | 45 (10)"Prioroffender",apersonwhohasbeenfoundguiltyofaviolationofthis |
|---|
| 1002 | | - | 46sectionwheresuchprioroffenseoccurredwithinfiveyearsoftheviolationforwhichthe |
|---|
| 1003 | | - | 47personischarged; |
|---|
| 1004 | | - | 48 (11)"Race",theoperationofoneormoremotorvehiclesarisingfroma |
|---|
| 1005 | | - | 49challengetodemonstratesuperiorityofamotorvehicleordriver,andtheacceptanceof |
|---|
| 1006 | | - | 50orcompetitiveresponsetothatchallenge,eitherthroughapriorarrangementorin |
|---|
| 1007 | | - | 51immediateresponse,inwhichthecompetitorattemptstooutgainoroutdistanceanother |
|---|
| 1008 | | - | 52motorvehicle,topreventanothermotorvehiclefrompassing,toarriveatagiven |
|---|
| 1009 | | - | 53destinationaheadofanothermotorvehicle,totestthephysicalstaminaorenduranceof |
|---|
| 1010 | | - | 54drivers,toexhibitspeedoracceleration,ortosetaspeedoraccelerationrecord; |
|---|
| 1011 | | - | 55 (12)"Streettakeover",theactofdisruptingtheregularflowoftrafficforthe |
|---|
| 1012 | | - | 56purposeofperforming,facilitating,orspectatingstuntdriving; |
|---|
| 1013 | | - | 57 (13)"Stuntdriving",tooperateamotorvehicleperformingarace,adragrace, |
|---|
| 1014 | | - | 58aburnout,adonut,awheelie,ordrifting; |
|---|
| 1015 | | - | 59 (14)"Wheelie",amotorvehiclemaneuverwherebyavehicleisriddenfora |
|---|
| 1016 | | - | 60distancewiththefrontorrearwheelorwheelsraisedofftheground. |
|---|
| 1017 | | - | 61 2.Exceptasotherwisepermittedbylaw,nopersonshall: |
|---|
| 1018 | | - | 62 (1)Performstuntdrivinginconnectionwithastreettakeover;or |
|---|
| 1019 | | - | 63 (2)Performorparticipateinastreettakeover. |
|---|
| 1020 | | - | 64 3.ViolationofthissectionshallbeaclassBmisdemeanorforafirstoffense,a |
|---|
| 1021 | | - | 65classAmisdemeanorforasecondoffense,andaclassEfelonyforathirdorsubsequent |
|---|
| 1022 | | - | 66offense. |
|---|
| 1023 | | - | SS#2SCSHCS#2HB495 28 67 4.Nodefendantallegedandproventobeaprioroffender,persistentoffender, |
|---|
| 1024 | | - | 68aggravatedoffender,chronicoffender,orhabitualoffendershallbegrantedasuspended |
|---|
| 1025 | | - | 69impositionofsentenceorbesentencedtopayafineinlieuofimprisonment. |
|---|
| 1026 | | - | 70 5.Nodefendantallegedandproventobeaprioroffendershallbegranted |
|---|
| 1027 | | - | 71probationorparoleuntilheorshehasservedaminimumoftendaysofimprisonment, |
|---|
| 1028 | | - | 72unlessasaconditionofsuchprobationorparolethepersonperformsatleastthirtydays |
|---|
| 1029 | | - | 73ofcommunityserviceunderthesupervisionofthecourtinajurisdictionthathasa |
|---|
| 1030 | | - | 74recognizedprogramforcommunityservice. |
|---|
| 1031 | | - | 75 6.Nodefendantallegedandproventobeanaggravatedoffendershallbeeligible |
|---|
| 1032 | | - | 76forprobationorparoleuntilheorshehasservedaminimumofthirtydaysof |
|---|
| 1033 | | - | 77imprisonment. |
|---|
| 1034 | | - | 78 7.Nodefendantallegedandproventobeachronicorhabitualoffendershallbe |
|---|
| 1035 | | - | 79eligibleforprobationorparoleuntilheorshehasservedaminimumofoneyearof |
|---|
| 1036 | | - | 80imprisonment. |
|---|
| 1037 | | - | 81 8.Priorpleasofguiltyandpriorfindingsofguiltyshallbepleadedandproven |
|---|
| 1038 | | - | 82inthesamemannerasrequiredbysection558.021. |
|---|
| 1039 | | - | 83 9.Thissectionshallnotapplytoeventssanctionedbyapoliticalsubdivisionor |
|---|
| 1040 | | - | 84privateentitywithresponsibilityformaintenanceandcontroloftheportionofhighway |
|---|
| 1041 | | - | 85orprivatepropertyonwhichthemotorvehicleoperationoccurs. |
|---|
| 1042 | | - | 455.095.1.Forpurposesofthissection,thefollowingtermsmean: |
|---|
| 1043 | | - | 2 (1)"Electronicmonitoringwithvictimnotification",anelectronicmonitoringsystem |
|---|
| 1044 | | - | 3thathasthecapabilitytotrackandmonitorthemovementofapersonandimmediately |
|---|
| 1045 | | - | 4transmitthemonitoredperson'slocationtotheprotectedpersonandthelocallaw |
|---|
| 1046 | | - | 5enforcementagencywithjurisdictionovertheprotectedpremisesthroughanappropriate |
|---|
| 1047 | | - | 6means,includingthetelephone,anelectronicbeeper,orpagingdevicewheneverthe |
|---|
| 1048 | | - | 7monitoredpersonenterstheprotectedpremisesasspecifiedintheorderbythecourt; |
|---|
| 1049 | | - | 8 (2)"Informedconsent",theprotectedpersonisgiventhefollowinginformation |
|---|
| 1050 | | - | 9beforeconsentingtoparticipateinelectronicmonitoringwithvictimnotification: |
|---|
| 1051 | | - | 10 (a)Theprotectedperson'srighttorefusetoparticipateinsuchmonitoringandthe |
|---|
| 1052 | | - | 11processforrequestingthecourttoterminatehisorherparticipationafterithasbeenordered; |
|---|
| 1053 | | - | 12 (b)Themannerinwhichtheelectronicmonitoringtechnologyfunctionsandtherisks |
|---|
| 1054 | | - | 13andlimitationsofthattechnology; |
|---|
| 1055 | | - | 14 (c)Theboundariesimposedonthepersonbeingmonitoredduringtheelectronic |
|---|
| 1056 | | - | 15monitoring; |
|---|
| 1057 | | - | 16 (d)Thesanctionsthatthecourtmayimposeforviolationsoftheorderissuedbythe |
|---|
| 1058 | | - | 17court; |
|---|
| 1059 | | - | SS#2SCSHCS#2HB495 29 18 (e)Theprocedurethattheprotectedpersonistofollowifthemonitoredperson |
|---|
| 1060 | | - | 19violatesanorderoriftheelectronicmonitoringequipmentfails; |
|---|
| 1061 | | - | 20 (f)Identificationofsupportservicesavailabletoassisttheprotectedpersonin |
|---|
| 1062 | | - | 21developingasafetyplantouseifthemonitoredpersonviolatesanorderoriftheelectronic |
|---|
| 1063 | | - | 22monitoringequipmentfails; |
|---|
| 1064 | | - | 23 (g)Identificationofcommunityservicesavailabletoassisttheprotectedpersonin |
|---|
| 1065 | | - | 24obtainingshelter,counseling,education,childcare,legalrepresentation,andotherhelpin |
|---|
| 1066 | | - | 25addressingtheconsequencesandeffectsofdomesticviolence;and |
|---|
| 1067 | | - | 26 (h)Thenonconfidentialnatureoftheprotectedperson'scommunicationswiththe |
|---|
| 1068 | | - | 27courtconcerningelectronicmonitoringandtherestrictionstobeimposeduponthemonitored |
|---|
| 1069 | | - | 28person'smovements. |
|---|
| 1070 | | - | 29 2.Whenapersonisfoundguiltyofviolatingthetermsandconditionsofanexparte |
|---|
| 1071 | | - | 30orfullorderofprotectionundersection455.085or455.538,thecourtmay,inadditiontoor |
|---|
| 1072 | | - | 31inlieuofanyotherdisposition: |
|---|
| 1073 | | - | 32 (1)Sentencethepersontoelectronicmonitoringwithvictimnotification;or |
|---|
| 1074 | | - | 33 (2)Placethepersononprobationand,asaconditionofsuchprobation,order |
|---|
| 1075 | | - | 34electronicmonitoringwithvictimnotification. |
|---|
| 1076 | | - | 35 3.Whenapersonchargedwithviolatingthetermsandconditionsofanexparteor |
|---|
| 1077 | | - | 36fullorderofprotectionundersection455.085or455.538isreleasedfromcustodybeforetrial |
|---|
| 1078 | | - | 37pursuanttosection544.455,thecourtmay,asaconditionofrelease,orderelectronic |
|---|
| 1079 | | - | 38monitoringofthepersonwithvictimnotification. |
|---|
| 1080 | | - | 39 4.Electronicmonitoringwithvictimnotificationshallbeorderedonlywiththe |
|---|
| 1081 | | - | 40protectedperson'sinformedconsent.Indeterminingwhethertoplaceapersononelectronic |
|---|
| 1082 | | - | 41monitoringwithvictimnotification,thecourtmayholdahearingtoconsiderthelikelihood |
|---|
| 1083 | | - | 42thattheperson'sparticipationinelectronicmonitoringwilldeterthepersonfrominjuringthe |
|---|
| 1084 | | - | 43protectedperson.Thecourtshallconsiderthefollowingfactors: |
|---|
| 1085 | | - | 44 (1)Thegravityandseriousnessofharmthatthepersoninflictedontheprotected |
|---|
| 1086 | | - | 45personinthecommissionofanyactofdomesticviolence; |
|---|
| 1087 | | - | 46 (2)Theperson'sprevioushistoryofdomesticviolence; |
|---|
| 1088 | | - | 47 (3)Theperson'shistoryofothercriminalacts,ifany; |
|---|
| 1089 | | - | 48 (4)Whetherthepersonhasaccesstoaweapon; |
|---|
| 1090 | | - | 49 (5)Whetherthepersonhasthreatenedsuicideorhomicide; |
|---|
| 1091 | | - | 50 (6)Whetherthepersonhasahistoryofmentalillnessorhasbeencivillycommitted; |
|---|
| 1092 | | - | 51and |
|---|
| 1093 | | - | 52 (7)Whetherthepersonhasahistoryofalcoholorsubstanceabuse. |
|---|
| 1094 | | - | 53 5.Unlessthepersonisdeterminedtobeindigentbythecourt,apersonorderedtobe |
|---|
| 1095 | | - | 54placedonelectronicmonitoringwithvictimnotificationshallbeorderedtopaytherelated |
|---|
| 1096 | | - | SS#2SCSHCS#2HB495 30 55costsandexpenses.Ifthecourtdeterminesthepersonisindigent,thepersonmaybeplaced |
|---|
| 1097 | | - | 56onelectronicmonitoringwithvictimnotification,andtheclerkofthecourtinwhichthecase |
|---|
| 1098 | | - | 57wasdeterminedshallnotifythedepartmentofcorrectionsthatthepersonwasdeterminedto |
|---|
| 1099 | | - | 58beindigentandshallincludeinabilltothedepartmentthecostsassociatedwiththe |
|---|
| 1100 | | - | 59monitoring.Thedepartmentshallestablishbyruleaproceduretodeterminetheportionof |
|---|
| 1101 | | - | 60costseachindigentpersonisabletopaybasedonaperson'sincome,numberofdependents, |
|---|
| 1102 | | - | 61andotherfactorsasdeterminedbythedepartmentandshallseekreimbursementofsuch |
|---|
| 1103 | | - | 62costs. |
|---|
| 1104 | | - | 63 6.Analertfromanelectronicmonitoringdeviceshallbeprobablecausetoarrestthe |
|---|
| 1105 | | - | 64monitoredpersonforaviolationofanexparteorfullorderofprotection. |
|---|
| 1106 | | - | 65 7.Thedepartmentofcorrections,departmentofpublicsafety,Missouristatehighway |
|---|
| 1107 | | - | 66patrol,thecircuitcourts,andcountyandmunicipallawenforcementagenciesshallshare |
|---|
| 1108 | | - | 67informationobtainedviaelectronicmonitoringconductedpursuanttothissection. |
|---|
| 1109 | | - | 68 8.Nosupplierofaproduct,system,orserviceusedforelectronicmonitoringwith |
|---|
| 1110 | | - | 69victimnotificationshallbeliable,directlyorindirectly,fordamagesarisingfromanyinjury |
|---|
| 1111 | | - | 70ordeathassociatedwiththeuseoftheproduct,system,orserviceunless,andonlytothe |
|---|
| 1112 | | - | 71extentthat,suchactionisbasedonaclaimthattheinjuryordeathwasproximatelycausedby |
|---|
| 1113 | | - | 72amanufacturingdefectintheproductorsystem. |
|---|
| 1114 | | - | 73 9.Nothinginthissectionshallbeconstruedaslimitingacourt'sabilitytoplacea |
|---|
| 1115 | | - | 74persononelectronicmonitoringwithoutvictimnotificationundersection544.455or |
|---|
| 1116 | | - | 75557.011. |
|---|
| 1117 | | - | 76 10.Apersonshallbefoundguiltyoftheoffenseoftamperingwithelectronic |
|---|
| 1118 | | - | 77monitoringequipmentundersection575.205ifheorshecommitstheactionsprohibited |
|---|
| 1119 | | - | 78undersuchsectionwithanyequipmentthatacourtordersthepersontowearunderthis |
|---|
| 1120 | | - | 79section. |
|---|
| 1121 | | - | 80 11.Thedepartmentofcorrectionsshallpromulgaterulesandregulationsforthe |
|---|
| 1122 | | - | 81implementationofsubsection5ofthissection.Anyruleorportionofarule,asthattermis |
|---|
| 1123 | | - | 82definedinsection536.010,thatiscreatedundertheauthoritydelegatedinthissectionshall |
|---|
| 1124 | | - | 83becomeeffectiveonlyifitcomplieswithandissubjecttoalloftheprovisionsofchapter536 |
|---|
| 1125 | | - | 84and,ifapplicable,section536.028.Thissectionandchapter536arenonseverableandifany |
|---|
| 1126 | | - | 85ofthepowersvestedwiththegeneralassemblypursuanttochapter536toreview,todelaythe |
|---|
| 1127 | | - | 86effectivedate,ortodisapproveandannularulearesubsequentlyheldunconstitutional,then |
|---|
| 1128 | | - | 87thegrantofrulemakingauthorityandanyruleproposedoradoptedafterAugust28,2018, |
|---|
| 1129 | | - | 88shallbeinvalidandvoid. |
|---|
| 1130 | | - | 89 [12.TheprovisionsofthissectionshallexpireonAugust28,2024.] |
|---|
| 1131 | | - | 491.065.1.Asusedinthissection,unlessthecontextotherwiserequires,the |
|---|
| 1132 | | - | 2followingtermsmean: |
|---|
| 1133 | | - | SS#2SCSHCS#2HB495 31 3 (1)"Benefit",anypleabargain,bailconsideration,reductionormodificationof |
|---|
| 1134 | | - | 4sentence,oranyotherleniency,immunity,financialpayment,reward,oramelioration |
|---|
| 1135 | | - | 5ofcurrentorfutureconditionsofincarcerationthathasbeenrequestedorthathasbeen |
|---|
| 1136 | | - | 6ormay,atafuturedate,beofferedorprovidedinconnectionwithorinexchangeforthe |
|---|
| 1137 | | - | 7testimonyofaninformantwhowasendorsedbythestate; |
|---|
| 1138 | | - | 8 (2)"Informant",awitnesswhoprovidestestimonythatoffersallegedlyself- |
|---|
| 1139 | | - | 9incriminatingstatementsoractivitiesofanotherpersonwhoisunderinvestigationor |
|---|
| 1140 | | - | 10beingchargedwithanoffense,andthewitness: |
|---|
| 1141 | | - | 11 (a)Isorwasincarceratedwiththesuspectordefendant; |
|---|
| 1142 | | - | 12 (b)Isbeingdetainedbyorinthecustodyoflawenforcement;or |
|---|
| 1143 | | - | 13 (c)Providestestimonyinexchangeforanybenefit. |
|---|
| 1144 | | - | 14 |
|---|
| 1145 | | - | 15Theterm"informant"shallnotrefertoorincludeacodefendantorvictiminvolvedin |
|---|
| 1146 | | - | 16thecase. |
|---|
| 1147 | | - | 17 2.BeginningJanuary1,2026,andthereafter,eachprosecutingorcircuit |
|---|
| 1148 | | - | 18attorneyshallsendtheinformationdescribedundersubdivision(4)ofsubsection2of |
|---|
| 1149 | | - | 19section56.750totheMissouriofficeofprosecutionservicestobeincludedinthe |
|---|
| 1150 | | - | 20summaryreportasdefinedinsubsection2ofsection56.750. |
|---|
| 1151 | | - | 21 3.Ifaprosecutingorcircuitattorneyendorsesawitnesstotestifyasan |
|---|
| 1152 | | - | 22informant,thefollowingmaterialandinformationshallbedisclosedtoallattorneysof |
|---|
| 1153 | | - | 23recordwithinfourteendaysoftheendorsementbytheprosecutingorcircuitattorney: |
|---|
| 1154 | | - | 24 (1)Thecompletecriminalhistoryoftheinformant,includinganychargesthat |
|---|
| 1155 | | - | 25arependingorwerereduced,amended,ordismissedaspartofapleabargain; |
|---|
| 1156 | | - | 26 (2)Theinformantcooperationagreementandacopyofanydeal,promise, |
|---|
| 1157 | | - | 27inducement,orbenefitthathasbeenrequestedorthathasbeenormay,atafuturedate, |
|---|
| 1158 | | - | 28beofferedorprovidedtotheinformantinconnectionwithtestimonyagainstthe |
|---|
| 1159 | | - | 29defendant'sinterest; |
|---|
| 1160 | | - | 30 (3)Thesubstance,time,andplaceofanystatementallegedlygivenbythe |
|---|
| 1161 | | - | 31defendanttotheinformant,andthesubstance,time,andplaceofanystatementgiven |
|---|
| 1162 | | - | 32bytheinformanttoalawenforcementagencyimplicatingthedefendantintheoffense |
|---|
| 1163 | | - | 33charged; |
|---|
| 1164 | | - | 34 (4)Whethertheinformantrecantedthattestimonyorstatementand,ifso,the |
|---|
| 1165 | | - | 35timeandplaceoftherecantation,thenatureoftherecantation,andthenamesofthe |
|---|
| 1166 | | - | 36personswhowerepresentattherecantation;and |
|---|
| 1167 | | - | 37 (5)Informationconcerningothercriminalcasesinanycountyinwhichthe |
|---|
| 1168 | | - | 38informantwasendorsedbythestatetotestifyagainstadefendant,includingthe |
|---|
| 1169 | | - | 39following: |
|---|
| 1170 | | - | SS#2SCSHCS#2HB495 32 40 (a)Thecasenameandnumber; |
|---|
| 1171 | | - | 41 (b)Thesubstanceofthetestimony; |
|---|
| 1172 | | - | 42 (c)Anycooperationagreement,deal,promise,inducement,orbenefitthatwas |
|---|
| 1173 | | - | 43requested,offered,orprovidedtotheinformantinconnectionwiththeinformant's |
|---|
| 1174 | | - | 44testimony;and |
|---|
| 1175 | | - | 45 (d)Anyotherinformationthatisrequestedtobedisclosedunderthe |
|---|
| 1176 | | - | 46ConstitutionoftheUnitedStates,theConstitutionofMissouri,andtheMissouri |
|---|
| 1177 | | - | 47supremecourtrulesofcriminalprocedure. |
|---|
| 1178 | | - | 513.605.Asusedinsections513.600to513.645,unlessthecontextclearlyindicates |
|---|
| 1179 | | - | 2otherwise,thefollowingtermsmean: |
|---|
| 1180 | | - | 3 (1)(a)"Beneficialinterest": |
|---|
| 1181 | | - | 4 a.Theinterestofapersonasabeneficiaryunderanyothertrustarrangementpursuant |
|---|
| 1182 | | - | 5towhichatrusteeholdslegalorrecordtitletorealpropertyforthebenefitofsuchperson;or |
|---|
| 1183 | | - | 6 b.Theinterestofapersonunderanyotherformofexpressfiduciaryarrangement |
|---|
| 1184 | | - | 7pursuanttowhichanyotherpersonholdslegalorrecordtitletorealpropertyforthebenefit |
|---|
| 1185 | | - | 8ofsuchperson; |
|---|
| 1186 | | - | 9 (b)"Beneficialinterest"doesnotincludetheinterestofastockholderinacorporation |
|---|
| 1187 | | - | 10ortheinterestofapartnerineitherageneralpartnershiporlimitedpartnership.Abeneficial |
|---|
| 1188 | | - | 11interestshallbedeemedtobelocatedwheretherealpropertyownedbythetrusteeislocated; |
|---|
| 1189 | | - | 12 (2)"Civilproceeding",anycivilsuitcommencedbyaninvestigativeagencyunder |
|---|
| 1190 | | - | 13anyprovisionofsections513.600to513.645; |
|---|
| 1191 | | - | 14 (3)"Criminalactivity"isthecommission,attemptedcommission,conspiracyto |
|---|
| 1192 | | - | 15commit,orthesolicitation,coercionorintimidationofanotherpersontocommitanycrime |
|---|
| 1193 | | - | 16whichischargeablebyindictmentorinformationunderthefollowingMissourilaws: |
|---|
| 1194 | | - | 17 (a)Chapter195,relatingtodrugregulations; |
|---|
| 1195 | | - | 18 (b)Chapter301,relatingtoregistrationandlicensingofmotorvehicles; |
|---|
| 1196 | | - | 19 (c)Chapter304,butrelatingonlytofelonyviolationsofthischapterinvolving |
|---|
| 1197 | | - | 20theuseofamotorvehicle; |
|---|
| 1198 | | - | 21 (d)Chapter311,butrelatingonlytofelonyviolationsofthischaptercommitted |
|---|
| 1199 | | - | 22bypersonsnotdulylicensedbythesupervisorofliquorcontrol; |
|---|
| 1200 | | - | 23 (e)Chapter409,relatingtoregulationofsecurities; |
|---|
| 1201 | | - | 24 (f)Chapter491,relatingtowitnesses; |
|---|
| 1202 | | - | 25 (g)Chapter565,relatingtooffensesagainsttheperson; |
|---|
| 1203 | | - | 26 [(c)](h)Chapter566,relatingtosexualoffenses; |
|---|
| 1204 | | - | 27 [(d)](i)Chapter567,relatingtoprostitution; |
|---|
| 1205 | | - | 28 (j)Chapter568,relatingtooffensesagainstthefamily; |
|---|
| 1206 | | - | 29 [(e)](k)Chapter569,relatingtorobbery,arson,burglaryandrelatedoffenses; |
|---|
| 1207 | | - | SS#2SCSHCS#2HB495 33 30 [(f)](l)Chapter570,relatingtostealingandrelatedoffenses; |
|---|
| 1208 | | - | 31 [(g)Chapter567,relatingtoprostitution; |
|---|
| 1209 | | - | 32 (h)](m)Chapter571,relatingtoweaponsoffenses; |
|---|
| 1210 | | - | 33 (n)Chapter572,relatingtogambling; |
|---|
| 1211 | | - | 34 (o)Chapter573,relatingtopornographyandrelatedoffenses; |
|---|
| 1212 | | - | 35 [(i)](p)Chapter574,relatingtooffensesagainstpublicorder; |
|---|
| 1213 | | - | 36 [(j)](q)Chapter575,relatingtooffensesagainsttheadministrationofjustice; |
|---|
| 1214 | | - | 37 [(k)Chapter491,relatingtowitnesses; |
|---|
| 1215 | | - | 38 (l)Chapter572,relatingtogambling; |
|---|
| 1216 | | - | 39 (m)Chapter311,butrelatingonlytofelonyviolationsofthischaptercommittedby |
|---|
| 1217 | | - | 40personsnotdulylicensedbythesupervisorofliquorcontrol; |
|---|
| 1218 | | - | 41 (n)Chapter571,relatingtoweaponsoffenses; |
|---|
| 1219 | | - | 42 (o)Chapter409,relatingtoregulationofsecurities; |
|---|
| 1220 | | - | 43 (p)Chapter301,relatingtoregistrationandlicensingofmotorvehicles] |
|---|
| 1221 | | - | 44 (r)Chapter578,butonlyrelatingtooffensesbyacriminalstreetgang; |
|---|
| 1222 | | - | 45 (4)"Criminalproceeding",anycriminalprosecutioncommencedbyaninvestigative |
|---|
| 1223 | | - | 46agencyunderanycriminallawofthisstate; |
|---|
| 1224 | | - | 47 (5)"Investigativeagency",theattorneygeneral'soffice,ortheofficeofany |
|---|
| 1225 | | - | 48prosecutingattorneyorcircuitattorney; |
|---|
| 1226 | | - | 49 (6)"Pecuniaryvalue": |
|---|
| 1227 | | - | 50 (a)Anythingofvalueintheformofmoney,anegotiableinstrument,acommercial |
|---|
| 1228 | | - | 51interest,oranythingelsetheprimarysignificanceofwhichiseconomicadvantage;or |
|---|
| 1229 | | - | 52 (b)Anyotherpropertyorservicethathasavalueinexcessofonehundreddollars; |
|---|
| 1230 | | - | 53 (7)"Realproperty",anyestateorlegalorequitableinterestinlandsituatedinthis |
|---|
| 1231 | | - | 54stateoranyinterestinsuchrealproperty,including,butnotlimitedto,anyleaseordeedof |
|---|
| 1232 | | - | 55trustuponsuchrealproperty; |
|---|
| 1233 | | - | 56 (8)"Seizingagency",theagencywhichistheprimaryemployeroftheofficeror |
|---|
| 1234 | | - | 57agentseizingtheproperty,includinganyagencyinwhichoneormoreoftheemployees |
|---|
| 1235 | | - | 58actingonbehalfoftheseizingagencyisemployedbythestateofMissourioranypolitical |
|---|
| 1236 | | - | 59subdivisionofthisstate; |
|---|
| 1237 | | - | 60 (9)"Seizure",thepointatwhichanylawenforcementofficeroragentdiscoversand |
|---|
| 1238 | | - | 61exercisesanycontroloverpropertythatanofficeroragenthasreasontobelievewasusedor |
|---|
| 1239 | | - | 62intendedforuseinthecourseof,derivedfrom,orrealizedthroughcriminalactivity.Seizure |
|---|
| 1240 | | - | 63includesbutisnotlimitedtopreventinganyonefoundinpossessionofthepropertyfrom |
|---|
| 1241 | | - | 64leavingthesceneoftheinvestigationwhileinpossessionoftheproperty; |
|---|
| 1242 | | - | 65 (10)(a)"Trustee": |
|---|
| 1243 | | - | SS#2SCSHCS#2HB495 34 66 a.Anypersonwhoholdslegalorrecordtitletorealpropertyforwhichanyother |
|---|
| 1244 | | - | 67personhasabeneficialinterest;or |
|---|
| 1245 | | - | 68 b.Anysuccessortrusteeortrusteestoanyoftheforegoingpersons; |
|---|
| 1246 | | - | 69 (b)"Trustee"doesnotincludethefollowing: |
|---|
| 1247 | | - | 70 a.Anypersonappointedoractingasapersonalrepresentativeunderchapter475or |
|---|
| 1248 | | - | 71underchapter473; |
|---|
| 1249 | | - | 72 b.Anypersonappointedoractingasatrusteeofanytestamentarytrustorastrustee |
|---|
| 1250 | | - | 73ofanyindentureoftrustunderwhichanybondsareoraretobeissued. |
|---|
| 1251 | | - | 556.061.Inthiscode,unlessthecontextrequiresadifferentdefinition,thefollowing |
|---|
| 1252 | | - | 2termsshallmean: |
|---|
| 1253 | | - | 3 (1)"Access",toinstruct,communicatewith,storedatain,retrieveorextractdata |
|---|
| 1254 | | - | 4from,orotherwisemakeanyuseofanyresourcesof,acomputer,computersystem,or |
|---|
| 1255 | | - | 5computernetwork; |
|---|
| 1256 | | - | 6 (2)"Affirmativedefense": |
|---|
| 1257 | | - | 7 (a)Thedefensereferredtoisnotsubmittedtothetrieroffactunlesssupportedby |
|---|
| 1258 | | - | 8evidence;and |
|---|
| 1259 | | - | 9 (b)Ifthedefenseissubmittedtothetrieroffactthedefendanthastheburdenof |
|---|
| 1260 | | - | 10persuasionthatthedefenseismoreprobablytruethannot; |
|---|
| 1261 | | - | 11 (3)"Burdenofinjectingtheissue": |
|---|
| 1262 | | - | 12 (a)Theissuereferredtoisnotsubmittedtothetrieroffactunlesssupportedby |
|---|
| 1263 | | - | 13evidence;and |
|---|
| 1264 | | - | 14 (b)Iftheissueissubmittedtothetrieroffactanyreasonabledoubtontheissue |
|---|
| 1265 | | - | 15requiresafindingforthedefendantonthatissue; |
|---|
| 1266 | | - | 16 (4)"Commercialfilmandphotographicprintprocessor",anypersonwhodevelops |
|---|
| 1267 | | - | 17exposedphotographicfilmintonegatives,slidesorprints,orwhomakesprintsfrom |
|---|
| 1268 | | - | 18negativesorslides,forcompensation.Thetermcommercialfilmandphotographicprint |
|---|
| 1269 | | - | 19processorshallincludeallemployeesofsuchpersonsbutshallnotincludeapersonwho |
|---|
| 1270 | | - | 20developsfilmormakesprintsforapublicagency; |
|---|
| 1271 | | - | 21 (5)"Computer",theboxthathousesthecentralprocessingunit(CPU),alongwith |
|---|
| 1272 | | - | 22anyinternalstoragedevices,suchasinternalharddrives,andinternalcommunication |
|---|
| 1273 | | - | 23devices,suchasinternalmodemscapableofsendingorreceivingelectronicmailorfaxcards, |
|---|
| 1274 | | - | 24alongwithanyotherhardwarestoredorhousedinternally.Thus,computerrefersto |
|---|
| 1275 | | - | 25hardware,softwareanddatacontainedinthemainunit.Printers,externalmodemsattached |
|---|
| 1276 | | - | 26bycabletothemainunit,monitors,andotherexternalattachmentswillbereferredto |
|---|
| 1277 | | - | 27collectivelyasperipheralsanddiscussedindividuallywhenappropriate.Whenthecomputer |
|---|
| 1278 | | - | 28andallperipheralsarereferredtoasapackage,theterm"computersystem"isused. |
|---|
| 1279 | | - | SS#2SCSHCS#2HB495 35 29Informationreferstoalltheinformationonacomputersystemincludingbothsoftware |
|---|
| 1280 | | - | 30applicationsanddata; |
|---|
| 1281 | | - | 31 (6)"Computerequipment",computers,terminals,datastoragedevices,andallother |
|---|
| 1282 | | - | 32computerhardwareassociatedwithacomputersystemornetwork; |
|---|
| 1283 | | - | 33 (7)"Computerhardware",allequipmentwhichcancollect,analyze,create,display, |
|---|
| 1284 | | - | 34convert,store,concealortransmitelectronic,magnetic,opticalorsimilarcomputerimpulses |
|---|
| 1285 | | - | 35ordata.Hardwareincludes,butisnotlimitedto,anydataprocessingdevices,suchascentral |
|---|
| 1286 | | - | 36processingunits,memorytypewritersandself-containedlaptopornotebookcomputers; |
|---|
| 1287 | | - | 37internalandperipheralstoragedevices,transistor-likebinarydevicesandothermemory |
|---|
| 1288 | | - | 38storagedevices,suchasfloppydisks,removabledisks,compactdisks,digitalvideodisks, |
|---|
| 1289 | | - | 39magnetictape,harddrive,opticaldisksanddigitalmemory;localareanetworks,suchastwo |
|---|
| 1290 | | - | 40ormorecomputersconnectedtogethertoacentralcomputerserverviacableormodem; |
|---|
| 1291 | | - | 41peripheralinputoroutputdevices,suchaskeyboards,printers,scanners,plotters,video |
|---|
| 1292 | | - | 42displaymonitorsandopticalreaders;andrelatedcommunicationdevices,suchasmodems, |
|---|
| 1293 | | - | 43cablesandconnections,recordingequipment,RAMorROMunits,acousticcouplers, |
|---|
| 1294 | | - | 44automaticdialers,speeddialers,programmabletelephonedialingorsignalingdevicesand |
|---|
| 1295 | | - | 45electronictone-generatingdevices;aswellasanydevices,mechanismsorpartsthatcanbe |
|---|
| 1296 | | - | 46usedtorestrictaccesstocomputerhardware,suchasphysicalkeysandlocks; |
|---|
| 1297 | | - | 47 (8)"Computernetwork",twoormoreinterconnectedcomputersorcomputer |
|---|
| 1298 | | - | 48systems; |
|---|
| 1299 | | - | 49 (9)"Computerprogram",asetofinstructions,statements,orrelateddatathatdirects |
|---|
| 1300 | | - | 50orisintendedtodirectacomputertoperformcertainfunctions; |
|---|
| 1301 | | - | 51 (10)"Computersoftware",digitalinformationwhichcanbeinterpretedbya |
|---|
| 1302 | | - | 52computerandanyofitsrelatedcomponentstodirectthewaytheywork.Softwareisstoredin |
|---|
| 1303 | | - | 53electronic,magnetic,opticalorotherdigitalform.Thetermcommonlyincludesprogramsto |
|---|
| 1304 | | - | 54runoperatingsystemsandapplications,suchaswordprocessing,graphic,orspreadsheet |
|---|
| 1305 | | - | 55programs,utilities,compilers,interpretersandcommunicationsprograms; |
|---|
| 1306 | | - | 56 (11)"Computer-relateddocumentation",written,recorded,printedorelectronically |
|---|
| 1307 | | - | 57storedmaterialwhichexplainsorillustrateshowtoconfigureorusecomputerhardware, |
|---|
| 1308 | | - | 58softwareorotherrelateditems; |
|---|
| 1309 | | - | 59 (12)"Computersystem",asetofrelated,connectedorunconnected,computer |
|---|
| 1310 | | - | 60equipment,data,orsoftware; |
|---|
| 1311 | | - | 61 (13)"Confinement": |
|---|
| 1312 | | - | 62 (a)Apersonisinconfinementwhensuchpersonisheldinaplaceofconfinement |
|---|
| 1313 | | - | 63pursuanttoarrestororderofacourt,andremainsinconfinementuntil: |
|---|
| 1314 | | - | 64 a.Acourtorderstheperson'srelease;or |
|---|
| 1315 | | - | 65 b.Thepersonisreleasedonbail,bond,orrecognizance,personalorotherwise;or |
|---|
| 1316 | | - | SS#2SCSHCS#2HB495 36 66 c.Apublicservanthavingthelegalpoweranddutytoconfinethepersonauthorizes |
|---|
| 1317 | | - | 67hisreleasewithoutguardandwithoutconditionthathereturntoconfinement; |
|---|
| 1318 | | - | 68 (b)Apersonisnotinconfinementif: |
|---|
| 1319 | | - | 69 a.Thepersonisonprobationorparole,temporaryorotherwise;or |
|---|
| 1320 | | - | 70 b.Thepersonisundersentencetoserveatermofconfinementwhichisnot |
|---|
| 1321 | | - | 71continuous,orisservingasentenceunderawork-releaseprogram,andineithersuchcaseis |
|---|
| 1322 | | - | 72notbeingheldinaplaceofconfinementorisnotbeingheldunderguardbyapersonhaving |
|---|
| 1323 | | - | 73thelegalpoweranddutytotransportthepersontoorfromaplaceofconfinement; |
|---|
| 1324 | | - | 74 (14)"Consent":consentorlackofconsentmaybeexpressedorimplied.Assent |
|---|
| 1325 | | - | 75doesnotconstituteconsentif: |
|---|
| 1326 | | - | 76 (a)Itisgivenbyapersonwholacksthementalcapacitytoauthorizetheconduct |
|---|
| 1327 | | - | 77chargedtoconstitutetheoffenseandsuchmentalincapacityismanifestorknowntothe |
|---|
| 1328 | | - | 78actor;or |
|---|
| 1329 | | - | 79 (b)Itisgivenbyapersonwhobyreasonofyouth,mentaldiseaseordefect, |
|---|
| 1330 | | - | 80intoxication,adrug-inducedstate,oranyotherreasonismanifestlyunableorknownbythe |
|---|
| 1331 | | - | 81actortobeunabletomakeareasonablejudgmentastothenatureorharmfulnessofthe |
|---|
| 1332 | | - | 82conductchargedtoconstitutetheoffense;or |
|---|
| 1333 | | - | 83 (c)Itisinducedbyforce,duressordeception; |
|---|
| 1334 | | - | 84 (15)"Controlledsubstance",adrug,substance,orimmediateprecursorinschedulesI |
|---|
| 1335 | | - | 85throughVasdefinedinchapter195; |
|---|
| 1336 | | - | 86 (16)"Criminalnegligence",failuretobeawareofasubstantialandunjustifiablerisk |
|---|
| 1337 | | - | 87thatcircumstancesexistoraresultwillfollow,andsuchfailureconstitutesagrossdeviation |
|---|
| 1338 | | - | 88fromthestandardofcarewhichareasonablepersonwouldexerciseinthesituation; |
|---|
| 1339 | | - | 89 (17)"Custody",apersonisincustodywhenheorshehasbeenarrestedbuthasnot |
|---|
| 1340 | | - | 90beendeliveredtoaplaceofconfinement; |
|---|
| 1341 | | - | 91 (18)"Damage",whenusedinrelationtoacomputersystemornetwork,meansany |
|---|
| 1342 | | - | 92alteration,deletion,ordestructionofanypartofthecomputersystemornetwork; |
|---|
| 1343 | | - | 93 (19)"Dangerousfelony",thefeloniesofarsoninthefirstdegree,assaultinthefirst |
|---|
| 1344 | | - | 94degree,attemptedrapeinthefirstdegreeifphysicalinjuryresults,attemptedforciblerapeif |
|---|
| 1345 | | - | 95physicalinjuryresults,attemptedsodomyinthefirstdegreeifphysicalinjuryresults, |
|---|
| 1346 | | - | 96attemptedforciblesodomyifphysicalinjuryresults,rapeinthefirstdegree,forciblerape, |
|---|
| 1347 | | - | 97sodomyinthefirstdegree,forciblesodomy,assaultintheseconddegreeifthevictimofsuch |
|---|
| 1348 | | - | 98assaultisaspecialvictimasdefinedinsubdivision(14)ofsection565.002,kidnappinginthe |
|---|
| 1349 | | - | 99firstdegree,kidnapping,murderintheseconddegree,assaultofalawenforcementofficerin |
|---|
| 1350 | | - | 100thefirstdegree,domesticassaultinthefirstdegree,elderabuseinthefirstdegree,robberyin |
|---|
| 1351 | | - | 101thefirstdegree,armedcriminalaction,conspiracytocommitanoffensewhentheoffenseisa |
|---|
| 1352 | | - | 102dangerousfelony,vehiclehijackingwhenpunishedasaclassAfelony,statutoryrapeinthe |
|---|
| 1353 | | - | SS#2SCSHCS#2HB495 37 103firstdegreewhenthevictimisachildlessthantwelveyearsofageatthetimeofthe |
|---|
| 1354 | | - | 104commissionoftheactgivingrisetotheoffense,statutorysodomyinthefirstdegreewhenthe |
|---|
| 1355 | | - | 105victimisachildlessthantwelveyearsofageatthetimeofthecommissionoftheactgiving |
|---|
| 1356 | | - | 106risetotheoffense,childmolestationinthefirstorseconddegree,abuseofachildifthechild |
|---|
| 1357 | | - | 107diesasaresultofinjuriessustainedfromconductchargeableundersection568.060,child |
|---|
| 1358 | | - | 108kidnapping,parentalkidnappingcommittedbydetainingorconcealingthewhereaboutsof |
|---|
| 1359 | | - | 109thechildfornotlessthanonehundredtwentydaysundersection565.153,bushijacking |
|---|
| 1360 | | - | 110whenpunishedasaclassAfelony,plantingabomborexplosiveinornearabusor |
|---|
| 1361 | | - | 111terminal,andan"intoxication-relatedtrafficoffense"or"intoxication-relatedboating |
|---|
| 1362 | | - | 112offense"ifthepersonisfoundtobea"habitualoffender"or"habitualboatingoffender"as |
|---|
| 1363 | | - | 113suchtermsaredefinedinsection577.001; |
|---|
| 1364 | | - | 114 (20)"Dangerousinstrument",anyinstrument,articleorsubstance,which,underthe |
|---|
| 1365 | | - | 115circumstancesinwhichitisused,isreadilycapableofcausingdeathorotherseriousphysical |
|---|
| 1366 | | - | 116injury; |
|---|
| 1367 | | - | 117 (21)"Data",arepresentationofinformation,facts,knowledge,concepts,or |
|---|
| 1368 | | - | 118instructionspreparedinaformalizedorothermannerandintendedforuseinacomputeror |
|---|
| 1369 | | - | 119computernetwork.Datamaybeinanyformincluding,butnotlimitedto,printouts, |
|---|
| 1370 | | - | 120microfiche,magneticstoragemedia,punchedcardsandasmaybestoredinthememoryofa |
|---|
| 1371 | | - | 121computer; |
|---|
| 1372 | | - | 122 (22)"Deadlyweapon",anyfirearm,loadedorunloaded,oranyweaponfromwhicha |
|---|
| 1373 | | - | 123shot,readilycapableofproducingdeathorseriousphysicalinjury,maybedischarged,ora |
|---|
| 1374 | | - | 124switchbladeknife,dagger,billyclub,blackjackormetalknuckles; |
|---|
| 1375 | | - | 125 (23)"Digitalcamera",acamerathatrecordsimagesinaformatwhichenablesthe |
|---|
| 1376 | | - | 126imagestobedownloadedintoacomputer; |
|---|
| 1377 | | - | 127 (24)"Disability",amental,physical,ordevelopmentalimpairmentthatsubstantially |
|---|
| 1378 | | - | 128limitsoneormoremajorlifeactivitiesortheabilitytoprovideadequatelyforone'scareor |
|---|
| 1379 | | - | 129protection,whethertheimpairmentiscongenitaloracquiredbyaccident,injuryordisease, |
|---|
| 1380 | | - | 130wheresuchimpairmentisverifiedbymedicalfindings; |
|---|
| 1381 | | - | 131 (25)"Elderlyperson",apersonsixtyyearsofageorolder; |
|---|
| 1382 | | - | 132 (26)"Felony",anoffensesodesignatedoranoffenseforwhichpersonsfoundguilty |
|---|
| 1383 | | - | 133thereofmaybesentencedtodeathorimprisonmentforatermofmorethanoneyear; |
|---|
| 1384 | | - | 134 (27)"Forciblecompulsion"either: |
|---|
| 1385 | | - | 135 (a)Physicalforcethatovercomesreasonableresistance;or |
|---|
| 1386 | | - | 136 (b)Athreat,expressorimplied,thatplacesapersoninreasonablefearofdeath, |
|---|
| 1387 | | - | 137seriousphysicalinjuryorkidnappingofsuchpersonoranotherperson; |
|---|
| 1388 | | - | SS#2SCSHCS#2HB495 38 138 (28)"Incapacitated",atemporaryorpermanentphysicalormentalconditioninwhich |
|---|
| 1389 | | - | 139apersonisunconscious,unabletoappraisethenatureofhisorherconduct,orunableto |
|---|
| 1390 | | - | 140communicateunwillingnesstoanact; |
|---|
| 1391 | | - | 141 (29)"Infraction",aviolationdefinedbythiscodeorbyanyotherstatuteofthisstate |
|---|
| 1392 | | - | 142ifitissodesignatedorifnosentenceotherthanafine,orfineandforfeitureorothercivil |
|---|
| 1393 | | - | 143penalty,isauthorizeduponconviction; |
|---|
| 1394 | | - | 144 (30)"Inhabitablestructure",avehicle,vesselorstructure: |
|---|
| 1395 | | - | 145 (a)Whereanypersonlivesorcarriesonbusinessorothercalling;or |
|---|
| 1396 | | - | 146 (b)Wherepeopleassembleforpurposesofbusiness,government,education,religion, |
|---|
| 1397 | | - | 147entertainment,orpublictransportation;or |
|---|
| 1398 | | - | 148 (c)Whichisusedforovernightaccommodationofpersons. |
|---|
| 1399 | | - | 149 |
|---|
| 1400 | | - | 150Anysuchvehicle,vessel,orstructureisinhabitableregardlessofwhetherapersonisactually |
|---|
| 1401 | | - | 151present.Ifabuildingorstructureisdividedintoseparatelyoccupiedunits,anyunitnot |
|---|
| 1402 | | - | 152occupiedbytheactorisaninhabitablestructureofanother; |
|---|
| 1403 | | - | 153 (31)"Knowingly",whenusedwithrespectto: |
|---|
| 1404 | | - | 154 (a)Conductorattendantcircumstances,meansapersonisawareofthenatureofhis |
|---|
| 1405 | | - | 155orherconductorthatthosecircumstancesexist;or |
|---|
| 1406 | | - | 156 (b)Aresultofconduct,meansapersonisawarethathisorherconductispractically |
|---|
| 1407 | | - | 157certaintocausethatresult; |
|---|
| 1408 | | - | 158 (32)"Lawenforcementofficer",anypublicservanthavingboththepoweranddutyto |
|---|
| 1409 | | - | 159makearrestsforviolationsofthelawsofthisstate,andfederallawenforcementofficers |
|---|
| 1410 | | - | 160authorizedtocarryfirearmsandtomakearrestsforviolationsofthelawsoftheUnited |
|---|
| 1411 | | - | 161States; |
|---|
| 1412 | | - | 162 (33)"Misdemeanor",anoffensesodesignatedoranoffenseforwhichpersonsfound |
|---|
| 1413 | | - | 163guiltythereofmaybesentencedtoimprisonmentforatermofwhichthemaximumisone |
|---|
| 1414 | | - | 164yearorless; |
|---|
| 1415 | | - | 165 (34)"Ofanother",propertythatanyentity,includingbutnotlimitedtoanynatural |
|---|
| 1416 | | - | 166person,corporation,limitedliabilitycompany,partnership,association,governmental |
|---|
| 1417 | | - | 167subdivisionorinstrumentality,otherthantheactor,hasapossessoryorproprietaryinterest |
|---|
| 1418 | | - | 168therein,exceptthatpropertyshallnotbedeemedpropertyofanotherwhohasonlyasecurity |
|---|
| 1419 | | - | 169interesttherein,eveniflegaltitleisinthecreditorpursuanttoaconditionalsalescontractor |
|---|
| 1420 | | - | 170othersecurityarrangement; |
|---|
| 1421 | | - | 171 (35)"Offense",anyfelonyormisdemeanor; |
|---|
| 1422 | | - | 172 (36)"Physicalinjury",slightimpairmentofanyfunctionofthebodyortemporary |
|---|
| 1423 | | - | 173lossofuseofanypartofthebody; |
|---|
| 1424 | | - | SS#2SCSHCS#2HB495 39 174 (37)"Placeofconfinement",anybuildingorfacilityandthegroundsthereofwherein |
|---|
| 1425 | | - | 175acourtislegallyauthorizedtoorderthatapersonchargedwithorconvictedofacrimebe |
|---|
| 1426 | | - | 176held; |
|---|
| 1427 | | - | 177 (38)"Possess"or"possessed",havingactualorconstructivepossessionofanobject |
|---|
| 1428 | | - | 178withknowledgeofitspresence.Apersonhasactualpossessionifsuchpersonhastheobject |
|---|
| 1429 | | - | 179onhisorherpersonorwithineasyreachandconvenientcontrol.Apersonhasconstructive |
|---|
| 1430 | | - | 180possessionifsuchpersonhasthepowerandtheintentionatagiventimetoexercisedominion |
|---|
| 1431 | | - | 181orcontrolovertheobjecteitherdirectlyorthroughanotherpersonorpersons.Possession |
|---|
| 1432 | | - | 182mayalsobesoleorjoint.Ifonepersonalonehaspossessionofanobject,possessionissole. |
|---|
| 1433 | | - | 183Iftwoormorepersonssharepossessionofanobject,possessionisjoint; |
|---|
| 1434 | | - | 184 (39)"Property",anythingofvalue,whetherrealorpersonal,tangibleorintangible,in |
|---|
| 1435 | | - | 185possessionorinaction; |
|---|
| 1436 | | - | 186 (40)"Publicservant",anypersonemployedinanywaybyagovernmentofthisstate |
|---|
| 1437 | | - | 187whoiscompensatedbythegovernmentbyreasonofsuchperson'semployment,anyperson |
|---|
| 1438 | | - | 188appointedtoapositionwithanygovernmentofthisstate,oranypersonelectedtoaposition |
|---|
| 1439 | | - | 189withanygovernmentofthisstate.Itincludes,butisnotlimitedto,legislators,jurors, |
|---|
| 1440 | | - | 190membersofthejudiciaryandlawenforcementofficers.Itdoesnotincludewitnesses; |
|---|
| 1441 | | - | 191 (41)"Purposely",whenusedwithrespecttoaperson'sconductortoaresultthereof, |
|---|
| 1442 | | - | 192meanswhenitishisorherconsciousobjecttoengageinthatconductortocausethatresult; |
|---|
| 1443 | | - | 193 (42)"Recklessly",consciouslydisregardingasubstantialandunjustifiableriskthat |
|---|
| 1444 | | - | 194circumstancesexistorthataresultwillfollow,andsuchdisregardconstitutesagross |
|---|
| 1445 | | - | 195deviationfromthestandardofcarewhichareasonablepersonwouldexerciseinthesituation; |
|---|
| 1446 | | - | 196 (43)"Seriousemotionalinjury",aninjurythatcreatesasubstantialriskoftemporary |
|---|
| 1447 | | - | 197orpermanentmedicalorpsychologicaldamage,manifestedbyimpairmentofabehavioral, |
|---|
| 1448 | | - | 198cognitiveorphysicalcondition.Seriousemotionalinjuryshallbeestablishedbytestimonyof |
|---|
| 1449 | | - | 199qualifiedexpertsuponthereasonableexpectationofprobableharmtoareasonabledegreeof |
|---|
| 1450 | | - | 200medicalorpsychologicalcertainty; |
|---|
| 1451 | | - | 201 (44)"Seriousphysicalinjury",physicalinjurythatcreatesasubstantialriskofdeath |
|---|
| 1452 | | - | 202orthatcausesseriousdisfigurementorprotractedlossorimpairmentofthefunctionofany |
|---|
| 1453 | | - | 203partofthebody; |
|---|
| 1454 | | - | 204 (45)"Services",whenusedinrelationtoacomputersystemornetwork,meansuseof |
|---|
| 1455 | | - | 205acomputer,computersystem,orcomputernetworkandincludes,butisnotlimitedto, |
|---|
| 1456 | | - | 206computertime,dataprocessing,andstorageorretrievalfunctions; |
|---|
| 1457 | | - | 207 (46)"Sexualorientation",maleorfemaleheterosexuality,homosexualityor |
|---|
| 1458 | | - | 208bisexualitybyinclination,practice,identityorexpression,orhavingaself-imageor |
|---|
| 1459 | | - | 209identitynottraditionallyassociatedwithone'sgender; |
|---|
| 1460 | | - | SS#2SCSHCS#2HB495 40 210 (47)"Vehicle",aself-propelledmechanicaldevicedesignedtocarryapersonor |
|---|
| 1461 | | - | 211persons,excludingvesselsoraircraft; |
|---|
| 1462 | | - | 212 (48)"Vessel",anyboatorcraftpropelledbyamotororbymachinery,whetherornot |
|---|
| 1463 | | - | 213suchmotorormachineryisaprincipalsourceofpropulsionusedorcapableofbeingusedas |
|---|
| 1464 | | - | 214ameansoftransportationonwater,oranyboatorcraftmorethantwelvefeetinlengthwhich |
|---|
| 1465 | | - | 215ispoweredbysailaloneorbyacombinationofsailandmachinery,andusedorcapableof |
|---|
| 1466 | | - | 216beingusedasameansoftransportationonwater,butnotanyboatorcrafthaving,astheonly |
|---|
| 1467 | | - | 217meansofpropulsion,apaddleoroars; |
|---|
| 1468 | | - | 218 (49)"Voluntaryact": |
|---|
| 1469 | | - | 219 (a)Abodilymovementperformedwhileconsciousasaresultofeffortor |
|---|
| 1470 | | - | 220determination.Possessionisavoluntaryactifthepossessorknowinglyprocuresorreceives |
|---|
| 1471 | | - | 221thethingpossessed,orhavingacquiredcontrolofitwasawareofhisorhercontrolfora |
|---|
| 1472 | | - | 222sufficienttimetohaveenabledhimorhertodisposeofitorterminatehisorhercontrol;or |
|---|
| 1473 | | - | 223 (b)Anomissiontoperformanactofwhichtheactorisphysicallycapable.Aperson |
|---|
| 1474 | | - | 224isnotguiltyofanoffensebasedsolelyuponanomissiontoperformanactunlessthelaw |
|---|
| 1475 | | - | 225definingtheoffenseexpresslysoprovides,oradutytoperformtheomittedactisotherwise |
|---|
| 1476 | | - | 226imposedbylaw; |
|---|
| 1477 | | - | 227 (50)"Vulnerableperson",anypersoninthecustody,care,orcontrolofthe |
|---|
| 1478 | | - | 228departmentofmentalhealthwhoisreceivingservicesfromanoperated,funded,licensed,or |
|---|
| 1479 | | - | 229certifiedprogram. |
|---|
| 1480 | | - | 566.210.1.Apersoncommitstheoffenseofsexualtraffickingofachildinthefirst |
|---|
| 1481 | | - | 2degreeifheorsheknowingly: |
|---|
| 1482 | | - | 3 (1)Recruits,entices,harbors,transports,provides,orobtainsbyanymeans,including |
|---|
| 1483 | | - | 4butnotlimitedtothroughtheuseofforce,abduction,coercion,fraud,deception,blackmail, |
|---|
| 1484 | | - | 5orcausingorthreateningtocausefinancialharm,apersonundertheageof[twelve] fourteen |
|---|
| 1485 | | - | 6toparticipateinacommercialsexact,asexualperformance,ortheproductionofexplicit |
|---|
| 1486 | | - | 7sexualmaterialasdefinedinsection573.010,orbenefits,financiallyorbyreceivinganything |
|---|
| 1487 | | - | 8ofvalue,fromparticipationinsuchactivities; |
|---|
| 1488 | | - | 9 (2)Causesapersonundertheageof[twelve] fourteentoengageinacommercialsex |
|---|
| 1489 | | - | 10act,asexualperformance,ortheproductionofexplicitsexualmaterialasdefinedinsection |
|---|
| 1490 | | - | 11573.010;or |
|---|
| 1491 | | - | 12 (3)Advertisestheavailabilityofapersonundertheageof[twelve] fourteento |
|---|
| 1492 | | - | 13participateinacommercialsexact,asexualperformance,ortheproductionofexplicitsexual |
|---|
| 1493 | | - | 14materialasdefinedinsection573.010. |
|---|
| 1494 | | - | 15 2.Itshallnotbeadefensethatthedefendantbelievedthatthepersonwas[twelve] |
|---|
| 1495 | | - | 16fourteenyearsofageorolder. |
|---|
| 1496 | | - | SS#2SCSHCS#2HB495 41 17 3.Theoffenseofsexualtraffickingofachildinthefirstdegreeisafelonyforwhich |
|---|
| 1497 | | - | 18theauthorizedtermofimprisonmentislifeimprisonmentwithouteligibilityforprobationor |
|---|
| 1498 | | - | 19paroleuntiltheoffenderhasservednotlessthan[twenty-five] thirtyyearsofsuchsentence. |
|---|
| 1499 | | - | 20Subsection4ofsection558.019shallnotapplytothesentenceofapersonwhohasbeen |
|---|
| 1500 | | - | 21foundguiltyofsexualtraffickingofachildlessthan[twelve] fourteenyearsofage,and"life |
|---|
| 1501 | | - | 22imprisonment"shallmeanimprisonmentforthedurationofaperson'snaturallifeforthe |
|---|
| 1502 | | - | 23purposesofthissection. |
|---|
| 1503 | | - | 566.211.1.Apersoncommitstheoffenseofsexualtraffickingofachildinthe |
|---|
| 1504 | | - | 2seconddegreeifheorsheknowingly: |
|---|
| 1505 | | - | 3 (1)Recruits,entices,harbors,transports,provides,orobtainsbyanymeans,including |
|---|
| 1506 | | - | 4butnotlimitedtothroughtheuseofforce,abduction,coercion,fraud,deception,blackmail, |
|---|
| 1507 | | - | 5orcausingorthreateningtocausefinancialharm,apersonundertheageofeighteento |
|---|
| 1508 | | - | 6participateinacommercialsexact,asexualperformance,ortheproductionofexplicitsexual |
|---|
| 1509 | | - | 7materialasdefinedinsection573.010,orbenefits,financiallyorbyreceivinganythingof |
|---|
| 1510 | | - | 8value,fromparticipationinsuchactivities; |
|---|
| 1511 | | - | 9 (2)Causesapersonundertheageofeighteentoengageinacommercialsexact,a |
|---|
| 1512 | | - | 10sexualperformance,ortheproductionofexplicitsexualmaterialasdefinedinsection |
|---|
| 1513 | | - | 11573.010;or |
|---|
| 1514 | | - | 12 (3)Advertisestheavailabilityofapersonundertheageofeighteentoparticipateina |
|---|
| 1515 | | - | 13commercialsexact,asexualperformance,ortheproductionofexplicitsexualmaterialas |
|---|
| 1516 | | - | 14definedinsection573.010. |
|---|
| 1517 | | - | 15 2.Itshallnotbeadefensethatthedefendantbelievedthatthepersonwaseighteen |
|---|
| 1518 | | - | 16yearsofageorolder. |
|---|
| 1519 | | - | 17 3.Theoffenseofsexualtraffickingofachildintheseconddegreeisafelony |
|---|
| 1520 | | - | 18punishablebyimprisonmentforatermofyearsnotlessthan[ten]twentyyearsorlifeanda |
|---|
| 1521 | | - | 19finenottoexceedtwohundredfiftythousanddollarsifthechildisundertheageofeighteen. |
|---|
| 1522 | | - | 20Ifaviolationofthissectionwaseffectedbyforce,abduction,orcoercion,thecrimeofsexual |
|---|
| 1523 | | - | 21traffickingofachildshallbeafelonyforwhichtheauthorizedtermofimprisonmentislife |
|---|
| 1524 | | - | 22imprisonmentwithouteligibilityforprobationorparoleuntilthedefendanthasservednot |
|---|
| 1525 | | - | 23lessthantwenty-fiveyearsofsuchsentence. |
|---|
| 1526 | | - | 568.045.1.Apersoncommitstheoffenseofendangeringthewelfareofachildinthe |
|---|
| 1527 | | - | 2firstdegreeifheorshe: |
|---|
| 1528 | | - | 3 (1)Knowinglyactsinamannerthatcreatesasubstantialrisktothelife,body,or |
|---|
| 1529 | | - | 4healthofachildlessthanseventeenyearsofage;[or] |
|---|
| 1530 | | - | 5 (2)Knowinglyengagesinsexualconductwithapersonundertheageofseventeen |
|---|
| 1531 | | - | 6yearsoverwhomthepersonisaparent,guardian,orotherwisechargedwiththecareand |
|---|
| 1532 | | - | 7custody; |
|---|
| 1533 | | - | SS#2SCSHCS#2HB495 42 8 (3)Knowinglyencourages,aidsorcausesachildlessthanseventeenyearsofageto |
|---|
| 1534 | | - | 9engageinanyconductwhichviolatestheprovisionsofchapter571or579;or |
|---|
| 1535 | | - | 10 (4)Inthepresenceofachildlessthanseventeenyearsofageorinaresidencewhere |
|---|
| 1536 | | - | 11achildlessthanseventeenyearsofageresides,unlawfullymanufacturesorattemptsto |
|---|
| 1537 | | - | 12manufacturecompounds,possesses,produces,prepares,sells,transports,testsoranalyzes |
|---|
| 1538 | | - | 13anyofthefollowing:fentanyl,carfentanil,amphetamine, ormethamphetamine, orany[of |
|---|
| 1539 | | - | 14itsanalogues] analoguethereof. |
|---|
| 1540 | | - | 15 2.TheoffenseofendangeringthewelfareofachildinthefirstdegreeisaclassD |
|---|
| 1541 | | - | 16felonyunlesstheoffense: |
|---|
| 1542 | | - | 17 (1)Iscommittedaspartofanactorseriesofactsperformedbytwoormorepersons |
|---|
| 1543 | | - | 18aspartofanestablishedorprescribedpatternofactivity,orwherephysicalinjurytothechild |
|---|
| 1544 | | - | 19results,ortheoffenseisasecondorsubsequentoffenseunderthissection,inwhichcasethe |
|---|
| 1545 | | - | 20offenseisaclassCfelony; |
|---|
| 1546 | | - | 21 (2)Involvesfentanylorcarfentanil,oranyanaloguethereof,inwhichcase: |
|---|
| 1547 | | - | 22 (a)TheoffenseisaclassBfelony;and |
|---|
| 1548 | | - | 23 (b)Apersonsentencedunderthissubdivisionshallnotbeeligibleforconditional |
|---|
| 1549 | | - | 24releaseorparoleuntilheorshehasservedatleastfiveyearsofimprisonment; |
|---|
| 1550 | | - | 25 (3)Resultsinseriousphysicalinjurytothechild,inwhichcasetheoffenseisaclass |
|---|
| 1551 | | - | 26Bfelony;or |
|---|
| 1552 | | - | 27 [(3)](4)Resultsinthedeathofachild,inwhichcasetheoffenseisaclassAfelony. |
|---|
| 1553 | | - | 570.030.1.Apersoncommitstheoffenseofstealingifheorshe: |
|---|
| 1554 | | - | 2 (1)Appropriatespropertyorservicesofanotherwiththepurposetodeprivehimor |
|---|
| 1555 | | - | 3herthereof,eitherwithouthisorherconsentorbymeansofdeceitorcoercion; |
|---|
| 1556 | | - | 4 (2)Attemptstoappropriateanhydrousammoniaorliquidnitrogenofanotherwiththe |
|---|
| 1557 | | - | 5purposetodeprivehimorherthereof,eitherwithouthisorherconsentorbymeansofdeceit |
|---|
| 1558 | | - | 6orcoercion;or |
|---|
| 1559 | | - | 7 (3)Forthepurposeofdeprivingtheownerofalawfulinteresttherein,receives, |
|---|
| 1560 | | - | 8retainsordisposesofpropertyofanotherknowingthatithasbeenstolen,orbelievingthatit |
|---|
| 1561 | | - | 9hasbeenstolen. |
|---|
| 1562 | | - | 10 2.TheoffenseofstealingisaclassAfelonyifthepropertyappropriatedconsistsof |
|---|
| 1563 | | - | 11anyofthefollowingcontaininganyamountofanhydrousammonia:atanktruck,tanktrailer, |
|---|
| 1564 | | - | 12railtankcar,bulkstoragetank,fieldnurse,fieldtankorfieldapplicator. |
|---|
| 1565 | | - | 13 3.TheoffenseofstealingisaclassBfelonyif: |
|---|
| 1566 | | - | 14 (1)Thepropertyappropriatedorattemptedtobeappropriatedconsistsofanyamount |
|---|
| 1567 | | - | 15ofanhydrousammoniaorliquidnitrogen; |
|---|
| 1568 | | - | 16 (2)Thepropertyconsistsofanyanimalconsideredlivestockasthetermlivestockis |
|---|
| 1569 | | - | 17definedinsection144.010,oranycaptivewildlifeheldunderpermitissuedbythe |
|---|
| 1570 | | - | SS#2SCSHCS#2HB495 43 18conservationcommission,andthevalueoftheanimaloranimalsappropriatedexceedsthree |
|---|
| 1571 | | - | 19thousanddollarsandthatpersonhaspreviouslybeenfoundguiltyofappropriatinganyanimal |
|---|
| 1572 | | - | 20consideredlivestockorcaptivewildlifeheldunderpermitissuedbytheconservation |
|---|
| 1573 | | - | 21commission.Notwithstandinganyprovisionoflawtothecontrary,suchpersonshallservea |
|---|
| 1574 | | - | 22minimumprisontermofnotlessthaneightypercentofhisorhersentencebeforeheorsheis |
|---|
| 1575 | | - | 23eligibleforprobation,parole,conditionalrelease,orotherearlyreleasebythedepartmentof |
|---|
| 1576 | | - | 24corrections; |
|---|
| 1577 | | - | 25 (3)Apersonappropriatespropertyconsistingofamotorvehicle,watercraft,or |
|---|
| 1578 | | - | 26aircraft,andthatpersonhaspreviouslybeenfoundguiltyoftwostealing-relatedoffenses |
|---|
| 1579 | | - | 27committedontwoseparateoccasionswheresuchoffensesoccurredwithintenyearsofthe |
|---|
| 1580 | | - | 28dateofoccurrenceofthepresentoffense; |
|---|
| 1581 | | - | 29 (4)Thepropertyappropriatedorattemptedtobeappropriatedconsistsofanyanimal |
|---|
| 1582 | | - | 30consideredlivestockasthetermisdefinedinsection144.010ifthevalueofthelivestock |
|---|
| 1583 | | - | 31exceedstenthousanddollars;[or] |
|---|
| 1584 | | - | 32 (5)Thepropertyappropriatedorattemptedtobeappropriatedisownedbyorinthe |
|---|
| 1585 | | - | 33custodyofafinancialinstitutionandthepropertyistakenorattemptedtobetakenphysically |
|---|
| 1586 | | - | 34fromanindividualpersontodeprivetheownerorcustodianoftheproperty; or |
|---|
| 1587 | | - | 35 (6)Thepersonappropriatesproperty,theperson'scourseofconductispartof |
|---|
| 1588 | | - | 36anorganizedretailtheft,andthevalueofthepropertytaken,combinedwithany |
|---|
| 1589 | | - | 37propertydamageinflictedinsuchtheft,istenthousanddollarsormore. |
|---|
| 1590 | | - | 38 4.TheoffenseofstealingisaclassCfelonyif: |
|---|
| 1591 | | - | 39 (1)Thevalueofthepropertyorservicesappropriatedistwenty-fivethousanddollars |
|---|
| 1592 | | - | 40ormore[or]; |
|---|
| 1593 | | - | 41 (2)Thepropertyisatellermachineorthecontentsofatellermachine,including |
|---|
| 1594 | | - | 42cash,regardlessofthevalueoramount; or |
|---|
| 1595 | | - | 43 (3)Thepersonappropriatesproperty,theperson'scourseofconductispartof |
|---|
| 1596 | | - | 44anorganizedretailtheft,andthevalueofthepropertytaken,combinedwithany |
|---|
| 1597 | | - | 45propertydamageinflictedinsuchtheft,issevenhundredfiftydollarsormorebutless |
|---|
| 1598 | | - | 46thantenthousanddollars. |
|---|
| 1599 | | - | 47 5.TheoffenseofstealingisaclassDfelonyif: |
|---|
| 1600 | | - | 48 (1)Thevalueofthepropertyorservicesappropriatedissevenhundredfiftydollarsor |
|---|
| 1601 | | - | 49more; |
|---|
| 1602 | | - | 50 (2)Theoffenderphysicallytakesthepropertyappropriatedfromthepersonofthe |
|---|
| 1603 | | - | 51victim;or |
|---|
| 1604 | | - | 52 (3)Thepropertyappropriatedconsistsof: |
|---|
| 1605 | | - | 53 (a)Anymotorvehicle,watercraftoraircraft; |
|---|
| 1606 | | - | 54 (b)Anywillorunrecordeddeedaffectingrealproperty; |
|---|
| 1607 | | - | SS#2SCSHCS#2HB495 44 55 (c)Anycreditdevice,debitdeviceorletterofcredit; |
|---|
| 1608 | | - | 56 (d)Anyfirearms; |
|---|
| 1609 | | - | 57 (e)Anyexplosiveweaponasdefinedinsection571.010; |
|---|
| 1610 | | - | 58 (f)AnyUnitedStatesnationalflagdesigned,intendedandusedfordisplayon |
|---|
| 1611 | | - | 59buildingsorstationaryflagstaffsintheopen; |
|---|
| 1612 | | - | 60 (g)Anyoriginalcopyofanact,billorresolution,introducedoracteduponbythe |
|---|
| 1613 | | - | 61legislatureofthestateofMissouri; |
|---|
| 1614 | | - | 62 (h)Anypleading,notice,judgmentoranyotherrecordorentryofanycourtofthis |
|---|
| 1615 | | - | 63state,anyotherstateoroftheUnitedStates; |
|---|
| 1616 | | - | 64 (i)Anybookofregistrationorlistofvotersrequiredbychapter115; |
|---|
| 1617 | | - | 65 (j)Anyanimalconsideredlivestockasthattermisdefinedinsection144.010; |
|---|
| 1618 | | - | 66 (k)Anylivefishraisedforcommercialsalewithavalueofseventy-fivedollarsor |
|---|
| 1619 | | - | 67more; |
|---|
| 1620 | | - | 68 (l)Anycaptivewildlifeheldunderpermitissuedbytheconservationcommission; |
|---|
| 1621 | | - | 69 (m)Anycontrolledsubstanceasdefinedbysection195.010; |
|---|
| 1622 | | - | 70 (n)Ammoniumnitrate; |
|---|
| 1623 | | - | 71 (o)Anywire,electricaltransformer,ormetallicwireassociatedwithtransmitting |
|---|
| 1624 | | - | 72telecommunications,video,internet,orvoiceoverinternetprotocolservice,oranyother |
|---|
| 1625 | | - | 73deviceorpipethatisassociatedwithconductingelectricityortransportingnaturalgasor |
|---|
| 1626 | | - | 74othercombustiblefuels;or |
|---|
| 1627 | | - | 75 (p)Anymaterialappropriatedwiththeintenttousesuchmaterialtomanufacture, |
|---|
| 1628 | | - | 76compound,produce,prepare,testoranalyzeamphetamineormethamphetamineoranyof |
|---|
| 1629 | | - | 77theiranalogues. |
|---|
| 1630 | | - | 78 6.TheoffenseofstealingisaclassEfelonyif: |
|---|
| 1631 | | - | 79 (1)Thepropertyappropriatedisananimal; |
|---|
| 1632 | | - | 80 (2)Thepropertyisacatalyticconverter; |
|---|
| 1633 | | - | 81 (3)Apersonhaspreviouslybeenfoundguiltyofthreestealing-relatedoffenses |
|---|
| 1634 | | - | 82committedonthreeseparateoccasionswheresuchoffensesoccurredwithintenyearsofthe |
|---|
| 1635 | | - | 83dateofoccurrenceofthepresentoffense;or |
|---|
| 1636 | | - | 84 (4)Thepropertyappropriatedisaletter,postalcard,package,bag,orothersealed |
|---|
| 1637 | | - | 85articlethatwasdeliveredbyacommoncarrierordeliveryserviceandnotyetreceivedbythe |
|---|
| 1638 | | - | 86addresseeorthathadbeenlefttobecollectedforshipmentbyacommoncarrierordelivery |
|---|
| 1639 | | - | 87service. |
|---|
| 1640 | | - | 88 7.TheoffenseofstealingisaclassDmisdemeanorifthepropertyisnotofatype |
|---|
| 1641 | | - | 89listedinsubsection2,3,5,or6ofthissection,thepropertyappropriatedhasavalueofless |
|---|
| 1642 | | - | 90thanonehundredfiftydollars,andthepersonhasnopreviousfindingsofguiltforastealing- |
|---|
| 1643 | | - | 91relatedoffense. |
|---|
| 1644 | | - | SS#2SCSHCS#2HB495 45 92 8.TheoffenseofstealingisaclassAmisdemeanorifnootherpenaltyisspecifiedin |
|---|
| 1645 | | - | 93thissection. |
|---|
| 1646 | | - | 94 9.Ifaviolationofthissectionissubjecttoenhancedpunishmentbasedonprior |
|---|
| 1647 | | - | 95findingsofguilt,suchfindingsofguiltshallbepleadedandproveninthesamemanneras |
|---|
| 1648 | | - | 96requiredbysection558.021. |
|---|
| 1649 | | - | 97 10.Theappropriationofanypropertyorservicesofatypelistedinsubsection2,3,5, |
|---|
| 1650 | | - | 98or6ofthissectionorofavalueofsevenhundredfiftydollarsormoremaybeconsidereda |
|---|
| 1651 | | - | 99separatefelonyandmaybechargedinseparatecounts. |
|---|
| 1652 | | - | 100 11.Thevalueofpropertyorservicesappropriatedpursuanttooneschemeorcourse |
|---|
| 1653 | | - | 101ofconduct,whetherfromthesameorseveralownersandwhetheratthesameordifferent |
|---|
| 1654 | | - | 102times,constitutesasinglecriminalepisodeandmaybeaggregatedindeterminingthegrade |
|---|
| 1655 | | - | 103oftheoffense,exceptassetforthinsubsection10ofthissection. |
|---|
| 1656 | | - | 104 12.Asusedinthissection,theterm"organizedretailtheft"means: |
|---|
| 1657 | | - | 105 (1)Anyactofstealingcommittedbyoneormorepersons,aspartofany |
|---|
| 1658 | | - | 106agreementtostealpropertyfromanybusiness,andseparateactsofstealingthatare |
|---|
| 1659 | | - | 107partofanyongoingagreementtostealmaybeaggregatedforthepurposeof |
|---|
| 1660 | | - | 108determiningvalueregardlessofwhethersuchactsarecommittedinthesame |
|---|
| 1661 | | - | 109jurisdictionoratthesametime; |
|---|
| 1662 | | - | 110 (2)Anyactofreceivingorpossessinganypropertythathasbeentakenorstolen |
|---|
| 1663 | | - | 111inviolationofsubdivision(1)ofthissubsectionwhileknowingorhavingreasonable |
|---|
| 1664 | | - | 112groundstobelievethepropertyisstolenfromanybusinessinviolationofthissection, |
|---|
| 1665 | | - | 113andseparateactsofreceivingorpossessingsuchstolenpropertythatarepartofany |
|---|
| 1666 | | - | 114ongoingagreementtoreceiveorpossesssuchstolenpropertymaybeaggregatedforthe |
|---|
| 1667 | | - | 115purposeofdeterminingvalueregardlessofwhethersuchactsarecommittedinthesame |
|---|
| 1668 | | - | 116jurisdictionoratthesametime;or |
|---|
| 1669 | | - | 117 (3)Anyactoforganizing,supervising,financing,leading,ormanagingbetween |
|---|
| 1670 | | - | 118oneormorepersonstoengageforprofitinaschemeorcourseofconducttoeffectuate |
|---|
| 1671 | | - | 119orintendtoeffectuatethetransferorsaleofpropertystolenfromanybusinessin |
|---|
| 1672 | | - | 120violationofthissection,andseparateactsoforganizing,supervising,financing,leading, |
|---|
| 1673 | | - | 121ormanagingbetweenoneormorepersonstoengageforprofitinaschemeorcourseof |
|---|
| 1674 | | - | 122conducttoeffectuateorintendtoeffectuatethetransferorsaleofsuchstolenproperty |
|---|
| 1675 | | - | 123thatarepartofanyongoingagreementtoorganize,supervise,finance,lead,ormanage |
|---|
| 1676 | | - | 124betweenoneormorepersonstoengageforprofitinaschemeorcourseofconductto |
|---|
| 1677 | | - | 125effectuateorintendtoeffectuatethetransferorsaleofsuchstolenpropertymaybe |
|---|
| 1678 | | - | 126aggregatedforthepurposeofdeterminingthevalueregardlessofwhethersuchactsare |
|---|
| 1679 | | - | 127committedinthesamejurisdictionoratthesametime. |
|---|
| 1680 | | - | SS#2SCSHCS#2HB495 46 128 13.Ifanyprosecutingattorneyorcircuitattorneymakesarequestinwritingto |
|---|
| 1681 | | - | 129theattorneygeneral,theattorneygeneralshallhavetheauthoritytocommenceand |
|---|
| 1682 | | - | 130prosecutetheoffenseofstealingifsuchoffenseinvolvesorganizedretailtheft,andany |
|---|
| 1683 | | - | 131otheroffensesthatdirectlyarisefromorcausallyoccurasaresultofanallegedviolation |
|---|
| 1684 | | - | 132oftheoffenseofstealinginvolvingorganizedretailtheft,ineachoranycountyoracity |
|---|
| 1685 | | - | 133notwithinacountyinwhichtheoffenseoccurredwiththesamepowerandauthority |
|---|
| 1686 | | - | 134grantedtoprosecutingattorneysinsection56.060andcircuitattorneysinsection |
|---|
| 1687 | | - | 13556.450,exceptthatallcostsandfeesofsuchprosecutionbytheattorneygeneralshallbe |
|---|
| 1688 | | - | 136paidbythestateandnotbyanycountyorlocalgovernment. |
|---|
| 1689 | | - | 137 14.Noprovisionofthissectionshallgrantanyadditionalpowertotheattorney |
|---|
| 1690 | | - | 138generalbeyondcommencementandprosecutionofoffensesasauthorizedinthissection. |
|---|
| 1691 | | - | 575.133.1.Apersoncommitstheoffenseoffilinganonconsensualcommonlawlien |
|---|
| 1692 | | - | 2ifheorshefilesadocumentthatpurportstoassertalienagainsttheassets,realorpersonal, |
|---|
| 1693 | | - | 3ofanypersonandthat,regardlessofanyself-description: |
|---|
| 1694 | | - | 4 (1)Isnotexpresslyprovidedforbyaspecificstateorfederalstatute; |
|---|
| 1695 | | - | 5 (2)Doesnotdependupontheconsentoftheownerofthepropertyaffectedorthe |
|---|
| 1696 | | - | 6existenceofacontractforitsexistence;and |
|---|
| 1697 | | - | 7 (3)Isnotanequitableorconstructivelienimposedbyastateorfederalcourtof |
|---|
| 1698 | | - | 8competentjurisdiction. |
|---|
| 1699 | | - | 9 2.Thissectionshallnotapplytoafilingofficerasdefinedinsection428.105thatis |
|---|
| 1700 | | - | 10actinginthescopeofhisorheremployment. |
|---|
| 1701 | | - | 11 3.TheoffenseoffilinganonconsensualcommonlawlienisaclassBmisdemeanor, |
|---|
| 1702 | | - | 12unlessitisasecondoffense,inwhichcaseitisaclassAmisdemeanor.Anythirdor |
|---|
| 1703 | | - | 13subsequentoffenseoffilinganonconsensualcommonlawlienisaclassEfelony.Any |
|---|
| 1704 | | - | 14personconvictedofathirdorsubsequentoffenseoffilinganonconsensualcommonlaw |
|---|
| 1705 | | - | 15lienshallbeconsideredapersistentoffender,assuchtermisdefinedinsection558.016. |
|---|
| 1706 | | - | 575.150.1.Apersoncommitstheoffenseofresistingorinterferingwitharrest, |
|---|
| 1707 | | - | 2detention,orstopifheorsheknowsorreasonablyshouldknowthatalawenforcement |
|---|
| 1708 | | - | 3officerismakinganarrestorattemptingtolawfullydetainorstopanindividualorvehicle, |
|---|
| 1709 | | - | 4andforthepurposeofpreventingtheofficerfromeffectingthearrest,stopordetention,heor |
|---|
| 1710 | | - | 5she: |
|---|
| 1711 | | - | 6 (1)Resiststhearrest,stopordetentionofsuchpersonbyusingorthreateningtheuse |
|---|
| 1712 | | - | 7ofviolenceorphysicalforceorbyfleeingfromsuchofficer;or |
|---|
| 1713 | | - | 8 (2)Interfereswiththearrest,stopordetentionofanotherpersonbyusingor |
|---|
| 1714 | | - | 9threateningtheuseofviolence,physicalforceorphysicalinterference. |
|---|
| 1715 | | - | 10 2.Thissectionappliesto: |
|---|
| 1716 | | - | 11 (1)Arrests,stops,ordetentions,withorwithoutwarrants; |
|---|
| 1717 | | - | SS#2SCSHCS#2HB495 47 12 (2)Arrests,stops,ordetentions,foranyoffense,infraction,orordinanceviolation; |
|---|
| 1718 | | - | 13and |
|---|
| 1719 | | - | 14 (3)Arrestsforwarrantsissuedbyacourtoraprobationandparoleofficer. |
|---|
| 1720 | | - | 15 3.Apersonispresumedtobefleeingavehiclestopifheorshecontinuestooperatea |
|---|
| 1721 | | - | 16motorvehicleafterheorshehasseenorshouldhaveseenclearlyvisibleemergencylightsor |
|---|
| 1722 | | - | 17hasheardorshouldhaveheardanaudiblesignalemanatingfromthelawenforcementvehicle |
|---|
| 1723 | | - | 18pursuinghimorher. |
|---|
| 1724 | | - | 19 4.Itisnodefensetoaprosecutionpursuanttosubsection1ofthissectionthatthelaw |
|---|
| 1725 | | - | 20enforcementofficerwasactingunlawfullyinmakingthearrest.However,nothinginthis |
|---|
| 1726 | | - | 21sectionshallbeconstruedtobarcivilsuitsforunlawfularrest. |
|---|
| 1727 | | - | 22 5.TheoffenseofresistingorinterferingwithanarrestisaclassEfelonyforanarrest |
|---|
| 1728 | | - | 23fora: |
|---|
| 1729 | | - | 24 (1)Felony; |
|---|
| 1730 | | - | 25 (2)Warrantissuedforfailuretoappearonafelonycase;or |
|---|
| 1731 | | - | 26 (3)Warrantissuedforaprobationviolationonafelonycase. |
|---|
| 1732 | | - | 27 |
|---|
| 1733 | | - | 28Theoffenseofresistinganarrest,detentionorstopinviolationofsubdivision(1)or(2)of |
|---|
| 1734 | | - | 29subsection1ofthissectionisaclassAmisdemeanor,unlessthepersonfleeingcreatesa |
|---|
| 1735 | | - | 30substantialriskofseriousphysicalinjuryordeathtoanyperson,inwhichcaseitisaclassE |
|---|
| 1736 | | - | 31felony. |
|---|
| 1737 | | - | 32 6.Inthecaseofaconvictionorapleaofguiltyunderthissectionthatissubject |
|---|
| 1738 | | - | 33topunishmentasaclassEfelony,anyvehicleusedinviolationofthissectionmaybe |
|---|
| 1739 | | - | 34impoundedandforfeitedpursuanttosection82.1000andsections513.600to513.645. |
|---|
| 1740 | | - | 576.030.1.Apersoncommitstheoffenseofobstructinggovernmentoperationsifhe |
|---|
| 1741 | | - | 2orshepurposelyobstructs,impairs,hindersorpervertstheperformanceofagovernmental |
|---|
| 1742 | | - | 3functionbytheuseorthreatofviolence,force,orotherphysicalinterferenceorobstacle. |
|---|
| 1743 | | - | 4 2.TheoffenseofobstructinggovernmentoperationsisaclassBmisdemeanor.The |
|---|
| 1744 | | - | 5offenseofobstructinggovernmentoperationsisaclassAmisdemeanoriftheperson |
|---|
| 1745 | | - | 6usesviolenceorforce. |
|---|
| 1746 | | - | 577.150.1.Apersoncommitstheoffenseoftamperingwithawatersupplyifheor |
|---|
| 1747 | | - | 2shepurposely: |
|---|
| 1748 | | - | 3 (1)Poisons,defiles, orinanywaycorruptsthewaterofawell,spring,brook, or |
|---|
| 1749 | | - | 4reservoirusedfordomesticormunicipalpurposes;or |
|---|
| 1750 | | - | 5 (2)Diverts,damsup,andholdsbackfromitsnaturalcourseandflowanyspring, |
|---|
| 1751 | | - | 6brook, orotherwatersupplyfordomesticormunicipalpurposes,aftersaidwatersupplyshall |
|---|
| 1752 | | - | 7haveoncebeentakenforusebyanypersonorpersons,corporation,town, orcityfortheir |
|---|
| 1753 | | - | 8use. |
|---|
| 1754 | | - | SS#2SCSHCS#2HB495 48 9 2.TheoffenseoftamperingwithawatersupplyisaclassEfelonywhentheoffense |
|---|
| 1755 | | - | 10isaviolationofsubdivision(1)ofsubsection1ofthissectionandisaclassA |
|---|
| 1756 | | - | 11misdemeanorwhentheoffenseisaviolationofsubdivision(2)ofsubsection1ofthis |
|---|
| 1757 | | - | 12section. |
|---|
| 1758 | | - | 590.040.1.ThePOSTcommissionshallsettheminimumnumberofhoursofbasic |
|---|
| 1759 | | - | 2trainingforlicensureasapeaceofficernolowerthansixhundred,withthefollowing |
|---|
| 1760 | | - | 3exceptions: |
|---|
| 1761 | | - | 4 (1)Uptoonethousandhoursmaybemandatedforanyclassoflicenserequiredfor |
|---|
| 1762 | | - | 5commissionbyastatelawenforcementagency; |
|---|
| 1763 | | - | 6 (2)Asfewasonehundredtwentyhoursmaybemandatedforanyclassoflicense |
|---|
| 1764 | | - | 7restrictedtocommissionasareservepeaceofficerwithpolicepowerslimitedtothe |
|---|
| 1765 | | - | 8commissioningpoliticalsubdivision; |
|---|
| 1766 | | - | 9 (3)PersonsvalidlylicensedonAugust28,2001,mayretainlicensurewithout |
|---|
| 1767 | | - | 10additionalbasictraining; |
|---|
| 1768 | | - | 11 (4)Personslicensedandcommissionedwithinacountyofthethirdclassification |
|---|
| 1769 | | - | 12beforeJuly1,2002,mayretainlicensurewithonehundredtwentyhoursofbasictrainingif |
|---|
| 1770 | | - | 13thecommissioningpoliticalsubdivisionhasadoptedanorderorordinancetothateffect; |
|---|
| 1771 | | - | 14 (5)PersonsservingasareserveofficeronAugust27,2001,withinacountyofthe |
|---|
| 1772 | | - | 15firstclassificationoracountywithacharterformofgovernmentandwithmorethanone |
|---|
| 1773 | | - | 16millioninhabitantsonAugust27,2001,havingpreviouslycompletedaminimumofone |
|---|
| 1774 | | - | 17hundredsixtyhoursoftraining,shallbegrantedalicensenecessarytofunctionasareserve |
|---|
| 1775 | | - | 18peaceofficeronlywithinsuchcounty.Forthepurposesofthissubdivision,theterm"reserve |
|---|
| 1776 | | - | 19officer"shallmeananypersonwhoservesinalessthanfull-timelawenforcementcapacity, |
|---|
| 1777 | | - | 20withorwithoutpayandwho,withoutcertification,hasnopowerofarrestandwho,without |
|---|
| 1778 | | - | 21certification,mustbeunderthedirectandimmediateaccompanimentofacertifiedpeace |
|---|
| 1779 | | - | 22officerofthesameagencyatalltimeswhileonduty;and |
|---|
| 1780 | | - | 23 (6)ThePOSTcommissionshallprovidefortherecognitionofbasictrainingreceived |
|---|
| 1781 | | - | 24atlawenforcementtrainingcentersofotherstates,themilitary,thefederalgovernmentand |
|---|
| 1782 | | - | 25territoriesoftheUnitedStatesregardlessofthenumberofhoursincludedinsuchtrainingand |
|---|
| 1783 | | - | 26shallhaveauthoritytorequiresupplementaltrainingasaconditionofeligibilityforlicensure. |
|---|
| 1784 | | - | 27 2.Thedirectorshallhavetheauthoritytolimitanyexceptionprovidedinsubsection |
|---|
| 1785 | | - | 281ofthissectiontopersonsremaininginthesamecommissionortransferringtoacommission |
|---|
| 1786 | | - | 29inasimilarjurisdiction. |
|---|
| 1787 | | - | 30 3.Thebasictrainingofeverypeaceofficer,exceptagentsoftheconservation |
|---|
| 1788 | | - | 31commission,shallincludeatleastthirtyhoursoftrainingintheinvestigationand |
|---|
| 1789 | | - | 32managementofcasesinvolvingdomesticandfamilyviolence.Suchtrainingshallinclude |
|---|
| 1790 | | - | 33instruction,specifictodomesticandfamilyviolencecases,regarding:reportwriting; |
|---|
| 1791 | | - | SS#2SCSHCS#2HB495 49 34physicalabuse,sexualabuse,childfatalitiesandchildneglect;interviewingchildrenand |
|---|
| 1792 | | - | 35allegedperpetrators;thenature,extentandcausesofdomesticandfamilyviolence;thesafety |
|---|
| 1793 | | - | 36ofvictims,otherfamilyandhouseholdmembersandinvestigatingofficers;legalrightsand |
|---|
| 1794 | | - | 37remediesavailabletovictims,includingrightstocompensationandtheenforcementofcivil |
|---|
| 1795 | | - | 38andcriminalremedies;servicesavailabletovictimsandtheirchildren;theeffectsofcultural, |
|---|
| 1796 | | - | 39racialandgenderbiasinlawenforcement;andstatestatutes.Saidcurriculumshallbe |
|---|
| 1797 | | - | 40developedandpresentedinconsultationwiththedepartmentofhealthandseniorservices,the |
|---|
| 1798 | | - | 41children'sdivision,publicandprivateprovidersofprogramsforvictimsofdomesticand |
|---|
| 1799 | | - | 42familyviolence,personswhohavedemonstratedexpertiseintrainingandeducation |
|---|
| 1800 | | - | 43concerningdomesticandfamilyviolence,andtheMissouricoalitionagainstdomestic |
|---|
| 1801 | | - | 44violence. |
|---|
| 1802 | | - | 45 4.ThebasictrainingofeverypeaceofficerfirstlicensedonorafterAugust28, |
|---|
| 1803 | | - | 462027,shallincludeatleastsixhoursoftrainingconcerningtheprohibitionagainstracial |
|---|
| 1804 | | - | 47profilingandsuchtrainingshallpromoteunderstandingandrespectforracialand |
|---|
| 1805 | | - | 48culturaldifferencesandtheuseofeffective,noncombativemethodsforcarryingoutlaw |
|---|
| 1806 | | - | 49enforcementdutiesinaraciallyandculturallydiverseenvironment.Suchtrainingshall |
|---|
| 1807 | | - | 50includetwohoursofracialprofilingtraining,twohoursofimplicitbiastraining,and |
|---|
| 1808 | | - | 51twohoursofde-escalationtraining. |
|---|
| 1809 | | - | 590.208.1.Thereisherebyestablishedthe"CommitteeonSchoolSafety" |
|---|
| 1810 | | - | 2withinthedepartmentofpublicsafety. |
|---|
| 1811 | | - | 3 2.Thecommitteeshallconsistofthefollowingmembers: |
|---|
| 1812 | | - | 4 (1)Uptothreerepresentativesofthedepartmentofpublicsafety; |
|---|
| 1813 | | - | 5 (2)ArepresentativeoftheMissouriSheriff'sAssociation; |
|---|
| 1814 | | - | 6 (3)ArepresentativeoftheMissouriMunicipalLeague; |
|---|
| 1815 | | - | 7 (4)Arepresentativeofthedepartmentofelementaryandsecondaryeducation; |
|---|
| 1816 | | - | 8and |
|---|
| 1817 | | - | 9 (5)ArepresentativeoftheMissouriSchoolBoards'Association'sCenterfor |
|---|
| 1818 | | - | 10EducationSafety. |
|---|
| 1819 | | - | 11 3.Onememberwhorepresentsthedepartmentofpublicsafetyshallserveas |
|---|
| 1820 | | - | 12chairofthecommittee. |
|---|
| 1821 | | - | 13 4.Membersofthecommitteeshallservewithoutcompensationbutmaybe |
|---|
| 1822 | | - | 14reimbursedforactualexpensesnecessarytotheperformanceoftheirofficialdutiesfor |
|---|
| 1823 | | - | 15thecommittee. |
|---|
| 1824 | | - | 16 5.Thecommitteeshallmeetatleastfourtimesperyear,andatleastonceper |
|---|
| 1825 | | - | 17calendarquarter,toevaluateandestablishguidelinesforschoolsafetyconcerns, |
|---|
| 1826 | | - | 18includingplanstopreventschoolfirearmviolence. |
|---|
| 1827 | | - | SS#2SCSHCS#2HB495 50 19 6.Exceptasprovidedinsection610.021,allmeetingsofthecommitteeshallbe |
|---|
| 1828 | | - | 20opentothepublic. |
|---|
| 1829 | | - | 21 7.Thecommitteeshallsubmitanannualreportinwritingtothegovernor, |
|---|
| 1830 | | - | 22presidentprotemporeofthesenate,andspeakerofthehouseofrepresentatives. |
|---|
| 1831 | | - | 595.209.1.Thefollowingrightsshallautomaticallybeaffordedtovictimsof |
|---|
| 1832 | | - | 2dangerousfelonies,asdefinedinsection556.061,victimsofmurderinthefirstdegree,as |
|---|
| 1833 | | - | 3definedinsection565.020,victimsofvoluntarymanslaughter,asdefinedinsection565.023, |
|---|
| 1834 | | - | 4victimsofanyoffenseunderchapter566,victimsofanattempttocommitoneofthe |
|---|
| 1835 | | - | 5precedingcrimes,asdefinedinsection562.012,andvictimsofdomesticassault,asdefinedin |
|---|
| 1836 | | - | 6sections565.072to565.076;and,uponwrittenrequest,thefollowingrightsshallbeafforded |
|---|
| 1837 | | - | 7tovictimsofallothercrimesandwitnessesofcrimes: |
|---|
| 1838 | | - | 8 (1)Forvictims,therighttobepresentatallcriminaljusticeproceedingsatwhichthe |
|---|
| 1839 | | - | 9defendanthassuchright,includingjuvenileproceedingswheretheoffensewouldhavebeena |
|---|
| 1840 | | - | 10felonyifcommittedbyanadult,evenifthevictimiscalledtotestifyormaybecalledto |
|---|
| 1841 | | - | 11testifyasawitnessinthecase; |
|---|
| 1842 | | - | 12 (2)Forvictims,therighttoinformationaboutthecrime,asprovidedforin |
|---|
| 1843 | | - | 13subdivision(5)ofthissubsection; |
|---|
| 1844 | | - | 14 (3)Forvictimsandwitnesses,tobeinformed,inatimelymanner,bytheprosecutor's |
|---|
| 1845 | | - | 15officeofthefilingofcharges,preliminaryhearingdates,trialdates,continuancesandthe |
|---|
| 1846 | | - | 16finaldispositionofthecase.Finaldispositioninformationshallbeprovidedwithinfivedays; |
|---|
| 1847 | | - | 17 (4)Forvictims,therighttoconferwithandtobeinformedbytheprosecutor |
|---|
| 1848 | | - | 18regardingbailhearings,guiltypleas,pleasunderchapter552oritssuccessors,hearings, |
|---|
| 1849 | | - | 19sentencingandprobationrevocationhearingsandtherighttobeheardatsuchhearings, |
|---|
| 1850 | | - | 20includingjuvenileproceedings,unlessinthedeterminationofthecourttheinterestsofjustice |
|---|
| 1851 | | - | 21requireotherwise; |
|---|
| 1852 | | - | 22 (5)Forvictims,therighttobeinformedbylocallawenforcementagencies,the |
|---|
| 1853 | | - | 23appropriatejuvenileauthoritiesorthecustodialauthorityofthefollowing: |
|---|
| 1854 | | - | 24 (a)Thestatusofanycaseconcerningacrimeagainstthevictim,includingjuvenile |
|---|
| 1855 | | - | 25offenses; |
|---|
| 1856 | | - | 26 (b)Therighttobeinformedbylocallawenforcementagenciesortheappropriate |
|---|
| 1857 | | - | 27juvenileauthoritiesoftheavailabilityofvictimcompensationassistance,assistancein |
|---|
| 1858 | | - | 28obtainingdocumentationofthevictim'slosses,including,butnotlimitedtoandsubjectto |
|---|
| 1859 | | - | 29existinglawconcerningprotectedinformationorclosedrecords,accesstocopiesof |
|---|
| 1860 | | - | 30complete,unaltered,uneditedinvestigationreportsofmotorvehicle,pedestrian,andother |
|---|
| 1861 | | - | 31similaraccidentsuponrequesttotheappropriatelawenforcementagencybythevictimorthe |
|---|
| 1862 | | - | 32victim'srepresentative,andemergencycrisisinterventionservicesavailableinthe |
|---|
| 1863 | | - | 33community; |
|---|
| 1864 | | - | SS#2SCSHCS#2HB495 51 34 (c)Anyreleaseofsuchpersononbondorforanyotherreason; |
|---|
| 1865 | | - | 35 (d)Withintwenty-fourhours,anyescapebysuchpersonfromamunicipaldetention |
|---|
| 1866 | | - | 36facility,countyjail,acorrectionalfacilityoperatedbythedepartmentofcorrections,mental |
|---|
| 1867 | | - | 37healthfacility,orthedivisionofyouthservicesoranyagencythereof,andanysubsequent |
|---|
| 1868 | | - | 38recaptureofsuchperson;and |
|---|
| 1869 | | - | 39 (e)Thenameofaninformantwhohasbeenendorsedundersection491.065asa |
|---|
| 1870 | | - | 40witnessbyaprosecutingorcircuitattorneyandanybenefitthathasbeenrequestedby |
|---|
| 1871 | | - | 41orhasbeenofferedtotheinformantandanybenefitthatmaybeprovidedatafuture |
|---|
| 1872 | | - | 42dateinconnectionwithsuchendorsement; |
|---|
| 1873 | | - | 43 (6)Forvictims,therighttobeinformedbyappropriatejuvenileauthoritiesof |
|---|
| 1874 | | - | 44probationrevocationhearingsinitiatedbythejuvenileauthorityandtherighttobeheardat |
|---|
| 1875 | | - | 45suchhearingsortoofferawrittenstatement,videooraudiotape,counselorarepresentative |
|---|
| 1876 | | - | 46designatedbythevictiminlieuofapersonalappearance,therighttobeinformedbythe |
|---|
| 1877 | | - | 47boardofprobationandparoleofprobationrevocationhearingsinitiatedbytheboardandof |
|---|
| 1878 | | - | 48parolehearings,therighttobepresentateachandeveryphaseofparolehearings,therightto |
|---|
| 1879 | | - | 49beheardatprobationrevocationandparolehearingsortoofferawrittenstatement,videoor |
|---|
| 1880 | | - | 50audiotape,counselorarepresentativedesignatedbythevictiminlieuofapersonal |
|---|
| 1881 | | - | 51appearance,andtherighttohave,uponwrittenrequestofthevictim,apartitionsetupinthe |
|---|
| 1882 | | - | 52probationorparolehearingroominsuchawaythatthevictimisshieldedfromtheviewof |
|---|
| 1883 | | - | 53theprobationerorparolee,andtherighttobeinformedbythecustodialmentalhealthfacility |
|---|
| 1884 | | - | 54oragencythereofofanyhearingsforthereleaseofapersoncommittedpursuanttothe |
|---|
| 1885 | | - | 55provisionsofchapter552,therighttobepresentatsuchhearings,therighttobeheardatsuch |
|---|
| 1886 | | - | 56hearingsortoofferawrittenstatement,videooraudiotape,counselorarepresentative |
|---|
| 1887 | | - | 57designatedbythevictiminlieuofpersonalappearance; |
|---|
| 1888 | | - | 58 (7)Forvictimsandwitnesses,upontheirwrittenrequest,therighttobeinformedby |
|---|
| 1889 | | - | 59theappropriatecustodialauthority,includinganymunicipaldetentionfacility,juvenile |
|---|
| 1890 | | - | 60detentionfacility,countyjail,correctionalfacilityoperatedbythedepartmentofcorrections, |
|---|
| 1891 | | - | 61mentalhealthfacility,divisionofyouthservicesoragencythereofiftheoffensewouldhave |
|---|
| 1892 | | - | 62beenafelonyifcommittedbyanadult,postconvictionorcommitmentpursuanttothe |
|---|
| 1893 | | - | 63provisionsofchapter552ofthefollowing: |
|---|
| 1894 | | - | 64 (a)Theprojecteddateofsuchperson'sreleasefromconfinement; |
|---|
| 1895 | | - | 65 (b)Anyreleaseofsuchpersononbond; |
|---|
| 1896 | | - | 66 (c)Anyreleaseofsuchpersononfurlough,workrelease,trialrelease,electronic |
|---|
| 1897 | | - | 67monitoringprogram,ortoacommunitycorrectionalfacilityorprogramorreleaseforany |
|---|
| 1898 | | - | 68otherreason,inadvanceofsuchrelease; |
|---|
| 1899 | | - | SS#2SCSHCS#2HB495 52 69 (d)Anyscheduledparoleorreleasehearings,includinghearingsundersection |
|---|
| 1900 | | - | 70217.362,regardingsuchpersonandanychangesintheschedulingofsuchhearings.Nosuch |
|---|
| 1901 | | - | 71hearingshallbeconductedwithoutthirtydays'advancenotice; |
|---|
| 1902 | | - | 72 (e)Withintwenty-fourhours,anyescapebysuchpersonfromamunicipaldetention |
|---|
| 1903 | | - | 73facility,countyjail,acorrectionalfacilityoperatedbythedepartmentofcorrections,mental |
|---|
| 1904 | | - | 74healthfacility,orthedivisionofyouthservicesoranyagencythereof,andanysubsequent |
|---|
| 1905 | | - | 75recaptureofsuchperson; |
|---|
| 1906 | | - | 76 (f)Anydecisionbyaparoleboard,byajuvenilereleasingauthorityorbyacircuit |
|---|
| 1907 | | - | 77courtpresidingoverreleasespursuanttotheprovisionsofchapter552,orbyacircuitcourt |
|---|
| 1908 | | - | 78presidingoverreleasesundersection217.362,toreleasesuchpersonoranydecisionbythe |
|---|
| 1909 | | - | 79governortocommutethesentenceofsuchpersonorpardonsuchperson;and |
|---|
| 1910 | | - | 80 (g)Notificationwithinthirtydaysofthedeathofsuchperson; |
|---|
| 1911 | | - | 81 (8)Forwitnesseswhohavebeensummonedbytheprosecutingattorneyandfor |
|---|
| 1912 | | - | 82victims,tobenotifiedbytheprosecutingattorneyinatimelymannerwhenacourt |
|---|
| 1913 | | - | 83proceedingwillnotgoonasscheduled; |
|---|
| 1914 | | - | 84 (9)Forvictimsandwitnesses,therighttoreasonableprotectionfromthedefendantor |
|---|
| 1915 | | - | 85anypersonactingonbehalfofthedefendantfromharmandthreatsofharmarisingoutof |
|---|
| 1916 | | - | 86theircooperationwithlawenforcementandprosecutionefforts; |
|---|
| 1917 | | - | 87 (10)Forvictimsandwitnesses,onchargedcasesorsubmittedcaseswherenocharge |
|---|
| 1918 | | - | 88decisionhasyetbeenmade,tobeinformedbytheprosecutingattorneyofthestatusofthe |
|---|
| 1919 | | - | 89caseandoftheavailabilityofvictimcompensationassistanceandoffinancialassistanceand |
|---|
| 1920 | | - | 90emergencyandcrisisinterventionservicesavailablewithinthecommunityandinformation |
|---|
| 1921 | | - | 91relativetoapplyingforsuchassistanceorservices,andofanyfinaldecisionbythe |
|---|
| 1922 | | - | 92prosecutingattorneynottofilecharges; |
|---|
| 1923 | | - | 93 (11)Forvictims,tobeinformedbytheprosecutingattorneyoftherighttorestitution |
|---|
| 1924 | | - | 94whichshallbeenforceableinthesamemannerasanyothercauseofactionasotherwise |
|---|
| 1925 | | - | 95providedbylaw; |
|---|
| 1926 | | - | 96 (12)Forvictimsandwitnesses,tobeinformedbythecourtandtheprosecuting |
|---|
| 1927 | | - | 97attorneyofprocedurestobefollowedinordertoapplyforandreceiveanywitnessfeeto |
|---|
| 1928 | | - | 98whichtheyareentitled; |
|---|
| 1929 | | - | 99 (13)Whenavictim'spropertyisnolongerneededforevidentiaryreasonsorneedsto |
|---|
| 1930 | | - | 100beretainedpendinganappeal,theprosecutingattorneyoranylawenforcementagency |
|---|
| 1931 | | - | 101havingpossessionofthepropertyshall,uponrequestofthevictim,returnsuchpropertytothe |
|---|
| 1932 | | - | 102victimwithinfiveworkingdaysunlessthepropertyiscontrabandorsubjecttoforfeiture |
|---|
| 1933 | | - | 103proceedings,orprovidewrittenexplanationofthereasonwhysuchpropertyshallnotbe |
|---|
| 1934 | | - | 104returned; |
|---|
| 1935 | | - | SS#2SCSHCS#2HB495 53 105 (14)Anemployermaynotdischargeordisciplineanywitness,victimormemberofa |
|---|
| 1936 | | - | 106victim'simmediatefamilyforhonoringasubpoenatotestifyinacriminalproceeding, |
|---|
| 1937 | | - | 107attendingacriminalproceeding,orforparticipatinginthepreparationofacriminal |
|---|
| 1938 | | - | 108proceeding,orrequireanywitness,victim,ormemberofavictim'simmediatefamilytouse |
|---|
| 1939 | | - | 109vacationtime,personaltime,orsickleaveforhonoringasubpoenatotestifyinacriminal |
|---|
| 1940 | | - | 110proceeding,attendingacriminalproceeding,orparticipatinginthepreparationofacriminal |
|---|
| 1941 | | - | 111proceeding.Apublicschooldistrict,publicschool,orcharterschoolshallnotdisciplinea |
|---|
| 1942 | | - | 112childforfailuretocomplywiththedistrict'sorschool'sattendancepolicy,andtheparentor |
|---|
| 1943 | | - | 113legalguardianshallnotbedeemedtobeinviolationoftheprovisionsofsection167.061,and |
|---|
| 1944 | | - | 114thedistrictorschoolshallnototherwisedisciplineachild,basedonsuchchild'shonoringa |
|---|
| 1945 | | - | 115subpoenatotestifyinacriminalproceeding,attendingacriminalproceeding,orfor |
|---|
| 1946 | | - | 116participatinginthepreparationofacriminalproceeding; |
|---|
| 1947 | | - | 117 (15)Forvictims,tobeprovidedwithcreditorintercessionservicesbytheprosecuting |
|---|
| 1948 | | - | 118attorneyifthevictimisunable,asaresultofthecrime,temporarilytomeetfinancial |
|---|
| 1949 | | - | 119obligations; |
|---|
| 1950 | | - | 120 (16)Forvictimsandwitnesses,therighttospeedydispositionoftheircases,andfor |
|---|
| 1951 | | - | 121victims,therighttospeedyappellatereviewoftheircases,providedthatnothinginthis |
|---|
| 1952 | | - | 122subdivisionshallpreventthedefendantfromhavingsufficienttimetopreparesuch |
|---|
| 1953 | | - | 123defendant'sdefense.Theattorneygeneralshallprovidevictims,upontheirwrittenrequest, |
|---|
| 1954 | | - | 124casestatusinformationthroughouttheappellateprocessoftheircases.Theprovisionsofthis |
|---|
| 1955 | | - | 125subdivisionshallapplyonlytoproceedingsinvolvingtheparticularcasetowhichtheperson |
|---|
| 1956 | | - | 126isavictimorwitness; |
|---|
| 1957 | | - | 127 (17)Forvictimsandwitnesses,tobeprovidedbythecourt,asecurewaitingarea |
|---|
| 1958 | | - | 128duringcourtproceedingsandtoreceivenotificationofthedate,timeandlocationofany |
|---|
| 1959 | | - | 129hearingconductedbythecourtforreconsiderationofanysentenceimposed,modificationof |
|---|
| 1960 | | - | 130suchsentenceorrecallandreleaseofanydefendantfromincarceration;and |
|---|
| 1961 | | - | 131 (18)Forvictims,therighttoreceiveuponrequestfromthedepartmentofcorrections |
|---|
| 1962 | | - | 132aphotographtakenofthedefendantpriortoreleasefromincarceration. |
|---|
| 1963 | | - | 133 2.Theprovisionsofsubsection1ofthissectionshallnotbeconstruedtoimplyany |
|---|
| 1964 | | - | 134victimwhoisincarceratedbythedepartmentofcorrectionsoranylocallawenforcement |
|---|
| 1965 | | - | 135agencyhasarighttobereleasedtoattendanyhearingorthatthedepartmentofcorrectionsor |
|---|
| 1966 | | - | 136thelocallawenforcementagencyhasanydutytotransportsuchincarceratedvictimtoany |
|---|
| 1967 | | - | 137hearing. |
|---|
| 1968 | | - | 138 3.Thosepersonsentitledtonoticeofeventspursuanttotheprovisionsofsubsection |
|---|
| 1969 | | - | 1391ofthissectionshallprovidetheappropriatepersonoragencywiththeircurrentaddresses, |
|---|
| 1970 | | - | 140electronicmailaddresses,andtelephonenumbersortheaddresses,electronicmailaddresses, |
|---|
| 1971 | | - | 141ortelephonenumbersatwhichtheywishnotificationtobegiven. |
|---|
| 1972 | | - | SS#2SCSHCS#2HB495 54 142 4.Notificationbytheappropriatepersonoragencyutilizingthestatewideautomated |
|---|
| 1973 | | - | 143crimevictimnotificationsystemasestablishedinsection650.310shallconstitutecompliance |
|---|
| 1974 | | - | 144withthevictimnotificationrequirementofthissection.Ifnotificationutilizingthestatewide |
|---|
| 1975 | | - | 145automatedcrimevictimnotificationsystemcannotbeused,thenwrittennotificationshallbe |
|---|
| 1976 | | - | 146sentbycertifiedmailorelectronicmailtothemostcurrentaddressorelectronicmailaddress |
|---|
| 1977 | | - | 147providedbythevictim. |
|---|
| 1978 | | - | 148 5.Victims'rightsasestablishedinSection32ofArticleIoftheMissouriConstitution |
|---|
| 1979 | | - | 149orthelawsofthisstatepertainingtotherightsofvictimsofcrimeshallbegrantedand |
|---|
| 1980 | | - | 150enforcedregardlessofthedesiresofadefendantandnoprivilegesofconfidentialityshall |
|---|
| 1981 | | - | 151existinfavorofthedefendanttoexcludevictimsorpreventtheirfullparticipationineachand |
|---|
| 1982 | | - | 152everyphaseofparolehearingsorprobationrevocationhearings.Therightsofthevictims |
|---|
| 1983 | | - | 153grantedinthissectionareabsoluteandthepolicyofthisstateisthatthevictim'srightsare |
|---|
| 1984 | | - | 154paramounttothedefendant'srights.Thevictimhasanabsoluterighttobepresentatany |
|---|
| 1985 | | - | 155hearinginwhichthedefendantispresentbeforeaprobationandparolehearingofficer. |
|---|
| 1986 | | - | 595.325.1.Thereisherebycreatedthe"MissingandMurderedAfrican |
|---|
| 1987 | | - | 2AmericanWomenandGirlsTaskForce"toconsistofthefollowingmembers: |
|---|
| 1988 | | - | 3 (1)Thefollowingfourmembersofthegeneralassembly: |
|---|
| 1989 | | - | 4 (a)Twomembersofthesenate,withonemembertobeappointedbythe |
|---|
| 1990 | | - | 5presidentprotemporeofthesenateandonemembertobeappointedbytheminority |
|---|
| 1991 | | - | 6floorleaderofthesenate;and |
|---|
| 1992 | | - | 7 (b)Twomembersofthehouseofrepresentatives,withonemembertobe |
|---|
| 1993 | | - | 8appointedbythespeakerofthehouseofrepresentativesandonemembertobe |
|---|
| 1994 | | - | 9appointedbytheminorityfloorleaderofthehouseofrepresentatives; |
|---|
| 1995 | | - | 10 (2)Thedirectorofthedepartmentofpublicsafetyorhisorherdesignee; |
|---|
| 1996 | | - | 11 (3)Tworepresentativesappointedbythedirectorofthedepartmentofpublic |
|---|
| 1997 | | - | 12safetyfromamongthefollowing: |
|---|
| 1998 | | - | 13 (a)AmemberfromtheMissouriPoliceChiefsAssociation; |
|---|
| 1999 | | - | 14 (b)AmemberfromtheMissouriSheriffsAssociation;or |
|---|
| 2000 | | - | 15 (c)ThesuperintendentoftheMissourihighwaypatrolorhisorherdesignee; |
|---|
| 2001 | | - | 16 (4)Oneormorerepresentativesappointedbythedirectorofpublicsafetyfrom |
|---|
| 2002 | | - | 17amongthefollowing: |
|---|
| 2003 | | - | 18 (a)Theattorneygeneralorhisorherdesignee; |
|---|
| 2004 | | - | 19 (b)ThedirectoroftheMissouriofficeofprosecutionservices; |
|---|
| 2005 | | - | 20 (c)ThepresidentoftheMissouriprosecutorsassociation; |
|---|
| 2006 | | - | 21 (d)Ajudgeorattorneyworkinginajuvenilecourt;or |
|---|
| 2007 | | - | 22 (e)AnattorneyworkingintheUnitedStatesAttorney'sOffice; |
|---|
| 2008 | | - | 23 (5)Acountycoronerorarepresentativefromastatewidecoroner'sassociation; |
|---|
| 2009 | | - | SS#2SCSHCS#2HB495 55 24 (6)Threeormorerepresentativesappointedbythedirectorofpublicsafety |
|---|
| 2010 | | - | 25fromamongthefollowing: |
|---|
| 2011 | | - | 26 (a)AstatewideorlocalorganizationthatprovideslegalservicestoAfrican |
|---|
| 2012 | | - | 27Americanwomenandgirls; |
|---|
| 2013 | | - | 28 (b)Astatewideorlocalorganizationthatprovidesadvocacyorcounselingfor |
|---|
| 2014 | | - | 29AfricanAmericanwomenandgirlswhohavebeenvictimsofviolence; |
|---|
| 2015 | | - | 30 (c)AstatewideorlocalorganizationthatprovidesservicestoAfricanAmerican |
|---|
| 2016 | | - | 31womenandgirls;or |
|---|
| 2017 | | - | 32 (d)AnAfricanAmericanwomanwhoisasurvivorofgenderviolence. |
|---|
| 2018 | | - | 33 2.Thetaskforceshallappointachairpersonwhoiselectedbyamajorityvoteof |
|---|
| 2019 | | - | 34themembersofthetaskforce.Thetaskforceshallhaveaninitialmeetingbefore |
|---|
| 2020 | | - | 35October1,2025.Themembersofthetaskforceshallservewithoutcompensation,but |
|---|
| 2021 | | - | 36shallbeentitledtonecessaryandactualexpensesincurredinattendingmeetingsofthe |
|---|
| 2022 | | - | 37taskforce. |
|---|
| 2023 | | - | 38 3.Thetaskforceshallexamineandreportonthefollowing: |
|---|
| 2024 | | - | 39 (1)ThesystemiccausesbehindviolencethatAfricanAmericanwomenandgirls |
|---|
| 2025 | | - | 40experience,includingpatternsandunderlyingfactorsthatexplainwhy |
|---|
| 2026 | | - | 41disproportionatelyhighlevelsofviolenceoccuragainstAfricanAmericanwomenand |
|---|
| 2027 | | - | 42girls,includingunderlyinghistorical,social,economic,institutional,andculturalfactors |
|---|
| 2028 | | - | 43thatmaycontributetotheviolence; |
|---|
| 2029 | | - | 44 (2)Appropriatemethodsfortrackingandcollectingdataonviolenceagainst |
|---|
| 2030 | | - | 45AfricanAmericanwomenandgirls,includingdataonmissingandmurderedAfrican |
|---|
| 2031 | | - | 46Americanwomenandgirls; |
|---|
| 2032 | | - | 47 (3)Policiesandinstitutionssuchaspolicing,childwelfare,coronerpractices, |
|---|
| 2033 | | - | 48andothergovernmentalpracticesthatimpactviolenceagainstAfricanAmerican |
|---|
| 2034 | | - | 49womenandgirlsandtheinvestigationandprosecutionofcrimesofgenderviolence |
|---|
| 2035 | | - | 50againstAfricanAmericanwomenandgirls; |
|---|
| 2036 | | - | 51 (4)MeasuresnecessarytoaddressandreduceviolenceagainstAfrican |
|---|
| 2037 | | - | 52Americanwomenandgirls;and |
|---|
| 2038 | | - | 53 (5)Measurestohelpvictims,victims'families,andvictims'communitiesprevent |
|---|
| 2039 | | - | 54andhealfromviolencethatoccursagainstAfricanAmericanwomenandgirls. |
|---|
| 2040 | | - | 55 4.Thedepartmentofpublicsafetyshallprovideadministrativesupporttothe |
|---|
| 2041 | | - | 56taskforce. |
|---|
| 2042 | | - | 57 5.OnorbeforeDecemberthirty-firstofeachyear,thetaskforceshallsubmita |
|---|
| 2043 | | - | 58reportonitsfindingstothegovernorandthegeneralassembly. |
|---|
| 2044 | | - | 59 6.ThetaskforceshallexpireonDecember31,2027,unlessextendeduntil |
|---|
| 2045 | | - | 60December31,2029,asdeterminednecessarybythedepartmentofpublicsafety. |
|---|
| 2046 | | - | SS#2SCSHCS#2HB495 56 650.058.1.Notwithstandingthesovereignimmunityofthestate,anyindividualwho |
|---|
| 2047 | | - | 2wasfoundguiltyofafelonyinaMissouricourtandwaslaterdeterminedtobeactually |
|---|
| 2048 | | - | 3innocentofsuchcrime[solelyasaresultofDNAprofilinganalysis] maybepaidrestitution. |
|---|
| 2049 | | - | 4Theindividualmayreceiveanamountofonehundredseventy-ninedollarsperdayforeach |
|---|
| 2050 | | - | 5dayofpostconvictionincarcerationforthecrimeforwhichtheindividualisdeterminedtobe |
|---|
| 2051 | | - | 6actuallyinnocent.Thepetitionforthepaymentofsaidrestitutionshallbefiledwiththe |
|---|
| 2052 | | - | 7sentencingcourt.Forthepurposesofthissection,theterm"actuallyinnocent"shallmean: |
|---|
| 2053 | | - | 8 (1)Theindividualwasconvictedofafelonyforwhichafinalorderofreleasewas |
|---|
| 2054 | | - | 9enteredbythecourt; |
|---|
| 2055 | | - | 10 (2)Allappealsoftheorderofreleasehavebeenexhausted; |
|---|
| 2056 | | - | 11 (3)Theindividualwasnotservinganytermofasentenceforanyothercrime |
|---|
| 2057 | | - | 12concurrentlywiththesentenceforwhichheorsheisdeterminedtobeactuallyinnocent, |
|---|
| 2058 | | - | 13unlesssuchindividualwasservinganotherconcurrentsentencebecausehisorherparolewas |
|---|
| 2059 | | - | 14revokedbyacourtortheparoleboardinconnectionwiththecrimeforwhichthepersonhas |
|---|
| 2060 | | - | 15beenexonerated.Regardlessofwhetheranyotherbasismayexistfortherevocationofthe |
|---|
| 2061 | | - | 16person'sprobationorparoleatthetimeofconvictionforthecrimeforwhichthepersonis |
|---|
| 2062 | | - | 17laterdeterminedtobeactuallyinnocent,whenthecourt'sortheparoleboard'ssolestated |
|---|
| 2063 | | - | 18reasonfortherevocationinitsorderistheconvictionforthecrimeforwhichthepersonis |
|---|
| 2064 | | - | 19laterdeterminedtobeactuallyinnocent,suchordershall,forpurposesofthissectiononly,be |
|---|
| 2065 | | - | 20conclusiveevidencethat[their] thepersons'sprobationorparolewasrevokedinconnection |
|---|
| 2066 | | - | 21withthecrimeforwhichthepersonhasbeenexonerated;and |
|---|
| 2067 | | - | 22 (4)Testingorderedundersection547.035,ortestingbytheorderofanystateor |
|---|
| 2068 | | - | 23federalcourt,ifsuchpersonwasexoneratedonorbeforeAugust28,2004,ortestingordered |
|---|
| 2069 | | - | 24undersection650.055,ifsuchpersonwasorisexoneratedafterAugust28,2004,orafteran |
|---|
| 2070 | | - | 25evidentiaryhearingandfindinginahabeascorpusproceedingoraproceedingheld |
|---|
| 2071 | | - | 26pursuanttosection547.031whichdemonstratesaperson'sinnocenceofthecrimeforwhich |
|---|
| 2072 | | - | 27thepersonisincustody. |
|---|
| 2073 | | - | 28 |
|---|
| 2074 | | - | 29Anyindividualwhoreceivesrestitutionunderthissectionshallbeprohibitedfromseeking |
|---|
| 2075 | | - | 30anycivilredressfromthestate,itsdepartmentsandagencies,oranyemployeethereof,orany |
|---|
| 2076 | | - | 31politicalsubdivisionoritsemployees.Thissectionshallnotbeconstruedasawaiverof |
|---|
| 2077 | | - | 32sovereignimmunityforanypurposesotherthantherestitutionprovidedforherein.The |
|---|
| 2078 | | - | 33departmentofcorrectionsshalldeterminetheaggregateamountofrestitutionowedduringa |
|---|
| 2079 | | - | 34fiscalyear.Ifinsufficientmoneysareappropriatedeachfiscalyeartopayrestitutiontosuch |
|---|
| 2080 | | - | 35persons,thedepartmentshallpayeachindividualwhohasreceivedanorderawarding |
|---|
| 2081 | | - | 36restitutionaproratashareoftheamountappropriated.Providedsufficientmoneysare |
|---|
| 2082 | | - | 37appropriatedtothedepartment,theamountsowedtosuchindividualshallbepaidonJune |
|---|
| 2083 | | - | SS#2SCSHCS#2HB495 57 38thirtiethofeachsubsequentfiscalyear,untilsuchtimeastherestitutiontotheindividualhas |
|---|
| 2084 | | - | 39beenpaidinfull.However,noindividualawardedrestitutionunderthissubsectionshall |
|---|
| 2085 | | - | 40receivemorethan[thirty-six] sixty-fivethousand[fivehundred] dollarsduringeachfiscal |
|---|
| 2086 | | - | 41year.Nointerestonunpaidrestitutionshallbeawardedtotheindividual.[Noindividualwho |
|---|
| 2087 | | - | 42hasbeendeterminedbythecourttobeactuallyinnocentshallberesponsibleforthecostsof |
|---|
| 2088 | | - | 43careundersection217.831] However,anindividualmayalsobeawardedother |
|---|
| 2089 | | - | 44nonmonetaryrelief,includingcounseling,housingassistance,andpersonalfinancial |
|---|
| 2090 | | - | 45literaryassistance. |
|---|
| 2091 | | - | 46 2.IftheresultsoftheDNAtestingconfirmtheperson'sguilt,thenthepersonfiling |
|---|
| 2092 | | - | 47forDNAtestingundersection547.035,shall: |
|---|
| 2093 | | - | 48 (1)BeliableforanyreasonablecostsincurredwhenconductingtheDNAtest, |
|---|
| 2094 | | - | 49includingbutnotlimitedtothecostofthetest.Suchcostsshallbedeterminedbythecourt |
|---|
| 2095 | | - | 50andshallbeincludedinthefindingsoffactandconclusionsoflawmadebythecourt;and |
|---|
| 2096 | | - | 51 (2)Besanctionedundertheprovisionsofsection217.262. |
|---|
| 2097 | | - | 52 3.Apetitionforpaymentofrestitutionunderthissectionmay[only] befiledonlyby |
|---|
| 2098 | | - | 53theindividualdeterminedtobeactuallyinnocentortheindividual'slegalguardian.Noclaim |
|---|
| 2099 | | - | 54orpetitionforrestitutionunderthissectionmaybefiledbytheindividual'sheirsorassigns. |
|---|
| 2100 | | - | 55Anindividual'srighttoreceiverestitutionunderthissectionisnotassignableorotherwise |
|---|
| 2101 | | - | 56transferrable.Thestate'sobligationtopayrestitutionunderthissectionshallceaseuponthe |
|---|
| 2102 | | - | 57individual'sdeath.Anybeneficiarydesignationthatpurportstobequeath,assign,or |
|---|
| 2103 | | - | 58otherwiseconveytherighttoreceivesuchrestitutionshallbevoidandunenforceable. |
|---|
| 2104 | | - | 59 4.Anindividualwhoisdeterminedtobeactuallyinnocentofacrimeunderthis |
|---|
| 2105 | | - | 60chaptershallautomaticallybegrantedanorderofexpungementfromthecourtinwhichheor |
|---|
| 2106 | | - | 61shepledguiltyorwassentencedtoexpungefromallofficialrecordsallrecordationsofhisor |
|---|
| 2107 | | - | 62herarrest,plea,trialorconviction.Uponthecourt'sgrantingoftheorderofexpungement, |
|---|
| 2108 | | - | 63therecordsandfilesmaintainedinanyadministrativeorcourtproceedinginanassociateor |
|---|
| 2109 | | - | 64circuitdivisionofthecourtshallbeconfidentialand[only] availableonlytothepartiesorby |
|---|
| 2110 | | - | 65orderofthecourtforgoodcauseshown.Theeffectofsuchordershallbetorestoresuch |
|---|
| 2111 | | - | 66persontothestatusheorsheoccupiedpriortosucharrest,pleaorconvictionandasifsuch |
|---|
| 2112 | | - | 67eventhadnevertakenplace.Nopersonastowhomsuchorderhasbeenenteredshallbeheld |
|---|
| 2113 | | - | 68thereafterunderanyprovisionofanylawtobeguiltyofperjuryorotherwisegivingafalse |
|---|
| 2114 | | - | 69statementbyreasonofhisorherfailuretoreciteoracknowledgesucharrest,plea,trial, |
|---|
| 2115 | | - | 70convictionorexpungementinresponsetoanyinquirymadeofhimorherforanypurpose |
|---|
| 2116 | | - | 71whatsoeverandnosuchinquiryshallbemadeforinformationrelatingtoanexpungement |
|---|
| 2117 | | - | 72underthissection. |
|---|
| 2118 | | - | Section1.Intheeventthatanysection,provision,clause,phrase,orwordofthis |
|---|
| 2119 | | - | 2actortheapplicationthereofisdeclaredinvalidundertheConstitutionoftheUnited |
|---|
| 2120 | | - | SS#2SCSHCS#2HB495 58 3StatesortheConstitutionoftheStateofMissouri,itistheintentofthegeneralassembly |
|---|
| 2121 | | - | 4thattheremainingsectionsofthisactremaininforceandeffectasfarastheyare |
|---|
| 2122 | | - | 5capableofbeingcarriedintoexecutionasintendedbythegeneralassembly.The |
|---|
| 2123 | | - | 6generalassemblyherebydeclaresthatitwouldhavepassedeachsection,provision, |
|---|
| 2124 | | - | 7clause,phrase,orwordthereof,irrespectiveofthefactthatanyoneormoresections, |
|---|
| 2125 | | - | 8provisions,clauses,phrases,orwordsofthisactortheapplicationofthisactwouldbe |
|---|
| 2126 | | - | 9declaredunenforceable,unconstitutional,orinvalid. |
|---|
| 2127 | | - | [84.175.1.Uponrecommendationofthechiefofpolice,theboard |
|---|
| 2128 | | - | 2 mayauthorizeandprovidefortheorganizationofapolicereserveforce |
|---|
| 2129 | | - | 3 composedofmemberswhoreceiveaserviceretirementundertheprovisions |
|---|
| 2130 | | - | 4 ofsections86.200to86.366andwhoqualifyundertheprovisionsofsection |
|---|
| 2131 | | - | 5 84.120.Suchreserveforceshallbeunderthecommandofthechiefofpolice |
|---|
| 2132 | | - | 6 andshallbeprovidedtraining,equipment,uniforms,andarmsasthechief |
|---|
| 2133 | | - | 7 shalldirectwiththeapprovaloftheboard.Membersofthereserveforceshall |
|---|
| 2134 | | - | 8 possessallofthepowersofregularpoliceofficersandshallbesubjecttoall |
|---|
| 2135 | | - | 9 lawsandregulationsapplicabletopoliceofficers;provided,however,thatthe |
|---|
| 2136 | | - | 10 citycouncilorothergoverningbodyofanysuchcitymayinitsdiscretionfixa |
|---|
| 2137 | | - | 11 totalinnumberwhichthereserveforcemaynotexceed. |
|---|
| 2138 | | - | 12 2.Ineventofriotorotheremergenciesasdeclaredanddefinedbythe |
|---|
| 2139 | | - | 13 mayor,inconcurrencewiththeboard,theboard,uponrecommendationofthe |
|---|
| 2140 | | - | 14 chief,mayappointspecialofficersorpatrolmenfortemporaryservicein |
|---|
| 2141 | | - | 15 additiontothepolicereserveforcehereinprovidedfor,butthelengthoftime |
|---|
| 2142 | | - | 16 forwhichsuchofficersorpatrolmenshallbeemployedshallbelimitedtothe |
|---|
| 2143 | | - | 17 timeduringwhichsuchemergencyshallexist.] |
|---|
| 2144 | | - | [84.240.Theboardofpolicecommissionersshallestablishthe |
|---|
| 2145 | | - | 2 Bertillonsystemofidentificationofcriminalsandothersbymeansof |
|---|
| 2146 | | - | 3 anthropometricindications,andtheyarefurtherrequiredtoemploysuch |
|---|
| 2147 | | - | 4 additionalassistanceasmaybenecessarytoproperlyconductandmanagethis |
|---|
| 2148 | | - | 5 department.] |
|---|
| 2149 | | - | [84.341.Noelectedorappointedofficialofthestateoranypolitical |
|---|
| 2150 | | - | 2 subdivisionthereofshallactorrefrainfromactinginanymannertoimpede, |
|---|
| 2151 | | - | 3 obstruct,hinder,orotherwiseinterferewithanymemberofamunicipalpolice |
|---|
| 2152 | | - | 4 forceestablishedundersections84.343to84.346intheperformanceofhisor |
|---|
| 2153 | | - | 5 herjobduties,orwithanyaspectofanyinvestigationarisingfromthe |
|---|
| 2154 | | - | 6 performanceofsuchjobduties.Thissectionshallnotbeconstruedtoprevent |
|---|
| 2155 | | - | 7 suchofficialsfromactingwithinthenormalcourseandscopeoftheir |
|---|
| 2156 | | - | 8 employmentorfromactingtoimplementsections84.343to84.346.Any |
|---|
| 2157 | | - | 9 personwhoviolatesthissectionshallbeliableforapenaltyoftwothousand |
|---|
| 2158 | | - | 10 fivehundreddollarsforeachoffenseandshallforeverbedisqualifiedfrom |
|---|
| 2159 | | - | 11 holdinganyofficeoremploymentwhatsoeverwiththegovernmentalentity |
|---|
| 2160 | | - | 12 thepersonservedatthetimeoftheviolation.Thepenaltyshallnotbepaidby |
|---|
| 2161 | | - | 13 thefundsofanycommitteeasthetermcommitteeisdefinedinsection |
|---|
| 2162 | | - | 14 130.011.Thissectionshallnotbeconstruedtointerferewiththepunishment, |
|---|
| 2163 | | - | SS#2SCSHCS#2HB495 59 15 underanylawsofthisstate,ofacriminaloffensecommittedbysuchofficials, |
|---|
| 2164 | | - | 16 norshallthissectionapplytodulyappointedmembersofthemunicipalpolice |
|---|
| 2165 | | - | 17 force,ortheirappointingauthorities,whoseconductisotherwiseprovidedfor |
|---|
| 2166 | | - | 18 bylaw.] |
|---|
| 2167 | | - | [84.342.1.Itshallbeanunlawfulemploymentpracticeforanofficial, |
|---|
| 2168 | | - | 2 employee,oragentofamunicipalpoliceforceestablishedundersections |
|---|
| 2169 | | - | 3 84.343to84.346todischarge,demote,reducethepayof,orotherwiseretaliate |
|---|
| 2170 | | - | 4 againstanemployeeofthemunicipalpoliceforceforreportingtoany |
|---|
| 2171 | | - | 5 superior,governmentagency,orthepresstheconductofanotheremployee |
|---|
| 2172 | | - | 6 thatthereportingemployeebelieves,ingoodfaith,isillegal. |
|---|
| 2173 | | - | 7 2.Anyemployeeofthemunicipalpoliceforcemaybringacauseof |
|---|
| 2174 | | - | 8 actionforgeneralorspecialdamagesbasedonaviolationofthissection.] |
|---|
| 2175 | | - | [84.343.1.Subjecttotheprovisionsofsections84.344to84.346,any |
|---|
| 2176 | | - | 2 citynotwithinacountymayestablishamunicipalpoliceforceforthe |
|---|
| 2177 | | - | 3 purposesof: |
|---|
| 2178 | | - | 4 (1)Preservingthepublicpeace,welfare,andorder; |
|---|
| 2179 | | - | 5 (2)Preventingcrimeandarrestingsuspectedoffenders; |
|---|
| 2180 | | - | 6 (3)Enforcingthelawsofthestateandordinancesofthecity; |
|---|
| 2181 | | - | 7 (4)Exercisingallpowersavailabletoapoliceforceundergenerally |
|---|
| 2182 | | - | 8 applicablestatelaw;and |
|---|
| 2183 | | - | 9 (5)Regulatingandlicensingallprivatewatchmen,privatedetectives, |
|---|
| 2184 | | - | 10 andprivatepolicemenservingoractingassuchinsaidcity. |
|---|
| 2185 | | - | 11 2.Anypersonwhoactsasaprivatewatchman,privatedetective,or |
|---|
| 2186 | | - | 12 privatepolicemaninsaidcitieswithouthavingobtainedawrittenlicensefrom |
|---|
| 2187 | | - | 13 saidcitiesisguiltyofaclassAmisdemeanor.] |
|---|
| 2188 | | - | [84.344.1.Notwithstandinganyprovisionsofthischaptertothe |
|---|
| 2189 | | - | 2 contrary,anycitynotwithinacountymayestablishamunicipalpoliceforce |
|---|
| 2190 | | - | 3 onorafterJuly1,2013,accordingtotheproceduresandrequirementsofthis |
|---|
| 2191 | | - | 4 section.Thepurposeoftheseproceduresandrequirementsistoprovideforan |
|---|
| 2192 | | - | 5 orderlyandappropriatetransitioninthegovernanceofthepoliceforceand |
|---|
| 2193 | | - | 6 provideforanequitableemploymenttransitionforcommissionedandcivilian |
|---|
| 2194 | | - | 7 personnel. |
|---|
| 2195 | | - | 8 2.Upontheestablishmentofamunicipalpoliceforcebyacityunder |
|---|
| 2196 | | - | 9 sections84.343to84.346,theboardofpolicecommissionersshallconvey, |
|---|
| 2197 | | - | 10 assign,andotherwisetransfertothecitytitleandownershipofall |
|---|
| 2198 | | - | 11 indebtednessandassets,including,butnotlimitedto,allfundsandrealand |
|---|
| 2199 | | - | 12 personalpropertyheldinthenameoforcontrolledbytheboardofpolice |
|---|
| 2200 | | - | 13 commissionerscreatedundersections84.010to84.340.Theboardofpolice |
|---|
| 2201 | | - | 14 commissionersshallexecutealldocumentsreasonablyrequiredtoaccomplish |
|---|
| 2202 | | - | 15 suchtransferofownershipandobligations. |
|---|
| 2203 | | - | 16 3.Ifthecityestablishesamunicipalpoliceforceandcompletesthe |
|---|
| 2204 | | - | 17 transferdescribedinsubsection2ofthissection,thecityshallprovidethe |
|---|
| 2205 | | - | 18 necessaryfundsforthemaintenanceofthemunicipalpoliceforce. |
|---|
| 2206 | | - | 19 4.Beforeacitynotwithinacountymayestablishamunicipalpolice |
|---|
| 2207 | | - | 20 forceunderthissection,thecityshalladoptanordinanceaccepting |
|---|
| 2208 | | - | SS#2SCSHCS#2HB495 60 21 responsibility,ownership,andliabilityassuccessor-in-interestforcontractual |
|---|
| 2209 | | - | 22 obligations,indebtedness,andotherlawfulobligationsoftheboardofpolice |
|---|
| 2210 | | - | 23 commissionerssubjecttotheprovisionsofsubsection2ofsection84.345. |
|---|
| 2211 | | - | 24 5.Acitynotwithinacountythatestablishesamunicipalpoliceforce |
|---|
| 2212 | | - | 25 shallinitiallyemploy,withoutareductioninrank,salary,orbenefits,all |
|---|
| 2213 | | - | 26 commissionedandcivilianpersonneloftheboardofpolicecommissioners |
|---|
| 2214 | | - | 27 createdundersections84.010to84.340thatwereemployedbytheboard |
|---|
| 2215 | | - | 28 immediatelypriortothedatethemunicipalpoliceforcewasestablished.Such |
|---|
| 2216 | | - | 29 commissionedpersonnelwhopreviouslywereemployedbytheboardmay |
|---|
| 2217 | | - | 30 onlybeinvoluntarilyterminatedbythecitynotwithinacountyforcause.The |
|---|
| 2218 | | - | 31 cityshallalsorecognizeallaccruedyearsofservicethatsuchcommissioned |
|---|
| 2219 | | - | 32 andcivilianpersonnelhadwiththeboardofpolicecommissioners.Such |
|---|
| 2220 | | - | 33 personnelshallbeentitledtothesameholidays,vacation,andsickleavethey |
|---|
| 2221 | | - | 34 wereentitledtoasemployeesoftheboardofpolicecommissioners. |
|---|
| 2222 | | - | 35 6.Commissionedandcivilianpersonnelofamunicipalpoliceforce |
|---|
| 2223 | | - | 36 establishedunderthissectionshallnotbesubjecttoaresidencyrequirementof |
|---|
| 2224 | | - | 37 retainingaprimaryresidenceinacitynotwithinacountybutmayberequired |
|---|
| 2225 | | - | 38 tomaintainaprimaryresidencelocatedwithinaone-hourresponsetime. |
|---|
| 2226 | | - | 39 7.Thecommissionedandcivilianpersonnelwhoretirefromservice |
|---|
| 2227 | | - | 40 withtheboardofpolicecommissionersbeforetheestablishmentofa |
|---|
| 2228 | | - | 41 municipalpoliceforceundersubsection1ofthissectionshallcontinuetobe |
|---|
| 2229 | | - | 42 entitledtothesamepensionbenefitsprovidedunderchapter86andthesame |
|---|
| 2230 | | - | 43 benefitssetforthinsubsection5ofthissection. |
|---|
| 2231 | | - | 44 8.Ifthecitynotwithinacountyelectstoestablishamunicipalpolice |
|---|
| 2232 | | - | 45 forceunderthissection,thecityshallestablishaseparatedivisionforthe |
|---|
| 2233 | | - | 46 operationofitsmunicipalpoliceforce.Thecivilservicecommissionofthe |
|---|
| 2234 | | - | 47 citymayadoptrulesandregulationsappropriatefortheuniqueoperationofa |
|---|
| 2235 | | - | 48 policedepartment.Suchrulesandregulationsshallreserveexclusive |
|---|
| 2236 | | - | 49 authorityoverthedisciplinaryprocessandproceduresaffectingcommissioned |
|---|
| 2237 | | - | 50 officerstothecivilservicecommission;however,untilsuchtimeasthecity |
|---|
| 2238 | | - | 51 adoptssuchrulesandregulations,thecommissionedpersonnelshallcontinue |
|---|
| 2239 | | - | 52 tobegovernedbytheboardofpolicecommissioner'srulesandregulationsin |
|---|
| 2240 | | - | 53 effectimmediatelypriortotheestablishmentofthemunicipalpoliceforce, |
|---|
| 2241 | | - | 54 withthepolicechiefactinginplaceoftheboardofpolicecommissionersfor |
|---|
| 2242 | | - | 55 purposesofapplyingtherulesandregulations.Unlessotherwiseprovidedfor, |
|---|
| 2243 | | - | 56 existingcivilservicecommissionrulesandregulationsgoverningtheappealof |
|---|
| 2244 | | - | 57 disciplinarydecisionstothecivilservicecommissionshallapplytoall |
|---|
| 2245 | | - | 58 commissionedandcivilianpersonnel.Thecivilservicecommission'srules |
|---|
| 2246 | | - | 59 andregulationsshallprovidethatrecordspreparedfordisciplinarypurposes |
|---|
| 2247 | | - | 60 shallbeconfidential,closedrecordsavailablesolelytothecivilservice |
|---|
| 2248 | | - | 61 commissionandthosewhopossessauthoritytoconductinvestigations |
|---|
| 2249 | | - | 62 regardingdisciplinarymatterspursuanttothecivilservicecommission'srules |
|---|
| 2250 | | - | 63 andregulations.Ahearingofficershallbeappointedbythecivilservice |
|---|
| 2251 | | - | 64 commissiontohearanysuchappealsthatinvolvedisciplineresultingina |
|---|
| 2252 | | - | 65 suspensionofgreaterthanfifteendays,demotion,ortermination,butthecivil |
|---|
| 2253 | | - | 66 servicecommissionshallmakethefinalfindingsoffact,conclusionsoflaw, |
|---|
| 2254 | | - | 67 anddecisionwhichshallbesubjecttoanyrightofappealunderchapter536. |
|---|
| 2255 | | - | SS#2SCSHCS#2HB495 61 68 9.Acitynotwithinacountythatestablishesandmaintainsa |
|---|
| 2256 | | - | 69 municipalpoliceforceunderthissection: |
|---|
| 2257 | | - | 70 (1)Shallprovideorcontractforlifeinsurancecoverageandfor |
|---|
| 2258 | | - | 71 insurancebenefitsprovidinghealth,medical,anddisabilitycoveragefor |
|---|
| 2259 | | - | 72 commissionedandcivilianpersonnelofthemunicipalpoliceforcetothesame |
|---|
| 2260 | | - | 73 extentaswasprovidedbytheboardofpolicecommissionersundersection |
|---|
| 2261 | | - | 74 84.160; |
|---|
| 2262 | | - | 75 (2)Shallprovideorcontractformedicalandlifeinsurancecoverage |
|---|
| 2263 | | - | 76 foranycommissionedorcivilianpersonnelwhoretiredfromservicewiththe |
|---|
| 2264 | | - | 77 boardofpolicecommissionersorwhowereemployedbytheboardofpolice |
|---|
| 2265 | | - | 78 commissionersandretirefromthemunicipalpoliceforceofacitynotwithina |
|---|
| 2266 | | - | 79 countytothesameextentsuchmedicalandlifeinsurancecoveragewas |
|---|
| 2267 | | - | 80 providedbytheboardofpolicecommissionersundersection84.160; |
|---|
| 2268 | | - | 81 (3)Shallmakeavailablemedicalandlifeinsurancecoveragefor |
|---|
| 2269 | | - | 82 purchasetothespousesordependentsofcommissionedandcivilianpersonnel |
|---|
| 2270 | | - | 83 whoretirefromservicewiththeboardofpolicecommissionersorthe |
|---|
| 2271 | | - | 84 municipalpoliceforceanddeceasedcommissionedandcivilianpersonnelwho |
|---|
| 2272 | | - | 85 receivepensionbenefitsundersections86.200to86.366attheratethatsuch |
|---|
| 2273 | | - | 86 dependent'sorspouse'scoveragewouldcostundertheappropriateplanifthe |
|---|
| 2274 | | - | 87 deceasedwereliving;and |
|---|
| 2275 | | - | 88 (4)Maypayanadditionalshiftdifferentialcompensationto |
|---|
| 2276 | | - | 89 commissionedandcivilianpersonnelforeveningandnighttoursofdutyin |
|---|
| 2277 | | - | 90 anamountnottoexceedtenpercentoftheofficer'sbasehourlyrate. |
|---|
| 2278 | | - | 91 10.Acitynotwithinacountythatestablishesamunicipalpoliceforce |
|---|
| 2279 | | - | 92 undersections84.343to84.346shallestablishatransitioncommitteeoffive |
|---|
| 2280 | | - | 93 membersforthepurposeof:coordinatingandimplementingthetransitionof |
|---|
| 2281 | | - | 94 authority,operations,assets,andobligationsfromtheboardofpolice |
|---|
| 2282 | | - | 95 commissionerstothecity;windingdowntheaffairsoftheboard;making |
|---|
| 2283 | | - | 96 nonbindingrecommendationsforthetransitionofthepoliceforcefromthe |
|---|
| 2284 | | - | 97 boardtothecity;andotherrelatedduties,ifany,establishedbyexecutive |
|---|
| 2285 | | - | 98 orderofthecity'smayor.Oncetheordinancereferencedinthissectionis |
|---|
| 2286 | | - | 99 enacted,thecityshallprovidewrittennoticetotheboardofpolice |
|---|
| 2287 | | - | 100 commissionersandthegovernorofthestateofMissouri.Withinthirty |
|---|
| 2288 | | - | 101 daysofsuchnotice,themayorshallappointthreememberstothecommittee, |
|---|
| 2289 | | - | 102 twoofwhomshallbemembersofastatewidelawenforcementassociation |
|---|
| 2290 | | - | 103 thatrepresentsatleastfivethousandlawenforcementofficers.Theremaining |
|---|
| 2291 | | - | 104 membersofthecommitteeshallincludethepolicechiefofthemunicipal |
|---|
| 2292 | | - | 105 policeforceandapersonwhocurrentlyorpreviouslyservedasa |
|---|
| 2293 | | - | 106 commissionerontheboardofpolicecommissioners,whoshallbeappointed |
|---|
| 2294 | | - | 107 tothecommitteebythemayorofsuchcity.] |
|---|
| 2295 | | - | [84.345.1.Exceptasrequiredfortheboardofpolicecommissioners |
|---|
| 2296 | | - | 2 toconcludeitsaffairsandpursuelegalclaimsanddefenses,uponthe |
|---|
| 2297 | | - | 3 establishmentofamunicipalpoliceforce,thetermsofofficeofthe |
|---|
| 2298 | | - | 4 commissionersoftheboardofpolicecreatedundersections84.020and |
|---|
| 2299 | | - | 5 84.030shallexpire,andtheprovisionsofsections84.010to84.340shallnot |
|---|
| 2300 | | - | 6 applytoanycitynotwithinacountyoritsmunicipalpoliceforceasofsuch |
|---|
| 2301 | | - | 7 date.Theboardshallcontinuetooperate,ifnecessary,towinddownthe |
|---|
| 2302 | | - | SS#2SCSHCS#2HB495 62 8 board'saffairsuntilthetransferofownershipandobligationsundersubsection |
|---|
| 2303 | | - | 9 2ofsection84.344hasbeencompleted.Duringsuchtime,theboardofpolice |
|---|
| 2304 | | - | 10 commissionersshalldesignateandauthorizeitssecretarytoactonbehalfof |
|---|
| 2305 | | - | 11 theboardforpurposesofperformingtheboard'sdutiesandanyotheractions |
|---|
| 2306 | | - | 12 incidenttothetransferandwindingdownoftheboard'saffairs. |
|---|
| 2307 | | - | 13 2.Foranyclaim,lawsuit,orotheractionarisingoutofactions |
|---|
| 2308 | | - | 14 occurringbeforethedateofcompletionofthetransferprovidedunder |
|---|
| 2309 | | - | 15 subsection2ofsection84.344,thestateshallcontinuetoprovidelegal |
|---|
| 2310 | | - | 16 representationassetforthinsection105.726,andthestatelegalexpensefund |
|---|
| 2311 | | - | 17 shallcontinuetoprovidereimbursementforsuchclaimsundersection |
|---|
| 2312 | | - | 18 105.726.Thissubsectionappliestoallclaims,lawsuits,andotheractions |
|---|
| 2313 | | - | 19 broughtagainstanycommissioner,policeofficer,employee,agent, |
|---|
| 2314 | | - | 20 representative,oranyindividualorentityactingorpurportingtoactonits |
|---|
| 2315 | | - | 21 ortheirbehalf. |
|---|
| 2316 | | - | 22 3.Notwithstandinganyotherprovisionoflaw,rule,orregulationto |
|---|
| 2317 | | - | 23 thecontrary,anycitynotwithinacountythatestablishesamunicipalpolice |
|---|
| 2318 | | - | 24 forceundersections84.343to84.346shallnotberestrictedorlimitedinany |
|---|
| 2319 | | - | 25 wayintheselectionofapolicechieforchiefofthedivisioncreatedunder |
|---|
| 2320 | | - | 26 subsection8ofsection84.344. |
|---|
| 2321 | | - | 27 4.Itshallbethedutyofthesheriffforanycitynotwithinacounty, |
|---|
| 2322 | | - | 28 whenevercalleduponbythepolicechiefofthemunicipalpoliceforce,toact |
|---|
| 2323 | | - | 29 underthepolicechief'scontrolforthepreservationofthepublicpeaceand |
|---|
| 2324 | | - | 30 quiet;and,whenevertheexigencyorcircumstancesmay,inthepolicechief's |
|---|
| 2325 | | - | 31 judgment,warrantit,saidpolicechiefshallhavethepowertoassumethe |
|---|
| 2326 | | - | 32 controlandcommandofalllocalandmunicipalconservatorsofthepeaceof |
|---|
| 2327 | | - | 33 thecity,whethersheriff,constable,policemenorothers,andtheyshallact |
|---|
| 2328 | | - | 34 undertheordersofthesaidpolicechiefandnototherwise.] |
|---|
| 2329 | | - | [84.346.Anypolicepensionsystemcreatedunderchapter86forthe |
|---|
| 2330 | | - | 2 benefitofapoliceforceestablishedundersections84.010to84.340shall |
|---|
| 2331 | | - | 3 continuetobegovernedbychapter86,andshallapplytoanypoliceforce |
|---|
| 2332 | | - | 4 establishedundersection84.343to84.346.Otherthananyprovisionthat |
|---|
| 2333 | | - | 5 makeschapter86applicabletoamunicipalpoliceforceestablishedunder |
|---|
| 2334 | | - | 6 section84.343to84.346,nothinginsections84.343to84.346shallbe |
|---|
| 2335 | | - | 7 construedaslimitingorchangingtherightsorbenefitsprovidedunderchapter |
|---|
| 2336 | | - | 8 86.] |
|---|
| 2337 | | - | [84.347.Notwithstandingtheprovisionsofsection1.140tothe |
|---|
| 2338 | | - | 2 contrary,theprovisionsofsections84.343to84.346shallbenonseverable.If |
|---|
| 2339 | | - | 3 anyprovisionofsections84.343to84.346isforanyreasonheldtobeinvalid, |
|---|
| 2340 | | - | 4 suchdecisionshallinvalidatealloftheremainingprovisionsofthisact.] |
|---|
| 2341 | | - | [217.825.Sections217.825to217.841shallbeknownandmaybe |
|---|
| 2342 | | - | 2 citedasthe"MissouriIncarcerationReimbursementAct".] |
|---|
| 2343 | | - | [217.827.Asusedinsections217.825to217.841,thefollowingterms |
|---|
| 2344 | | - | 2 shallmean: |
|---|
| 2345 | | - | SS#2SCSHCS#2HB495 63 3 (1)(a)"Assets",property,tangibleorintangible,realorpersonal, |
|---|
| 2346 | | - | 4 belongingtoordueanoffenderoraformeroffender,includingincomeor |
|---|
| 2347 | | - | 5 paymentstosuchoffenderfromSocialSecurity,workers'compensation, |
|---|
| 2348 | | - | 6 veterans'compensation,pensionbenefits,previouslyearnedsalaryorwages, |
|---|
| 2349 | | - | 7 bonuses,annuities,retirementbenefits,orfromanyothersourcewhatsoever, |
|---|
| 2350 | | - | 8 includinganyofthefollowing: |
|---|
| 2351 | | - | 9 a.Moneyorothertangibleassetsreceivedbytheoffenderasaresult |
|---|
| 2352 | | - | 10 ofasettlementofaclaimagainstthestate,anyagencythereof,oranyclaim |
|---|
| 2353 | | - | 11 againstanemployeeorindependentcontractorarisingfromandinthescopeof |
|---|
| 2354 | | - | 12 saidemployee'sorcontractor'sofficialdutiesonbehalfofthestateorany |
|---|
| 2355 | | - | 13 agencythereof; |
|---|
| 2356 | | - | 14 b.Amoneyjudgmentreceivedbytheoffenderfromthestateasa |
|---|
| 2357 | | - | 15 resultofacivilactioninwhichthestate,anagencythereoforanystate |
|---|
| 2358 | | - | 16 employeeorindependentcontractorwheresuchjudgmentarosefromaclaim |
|---|
| 2359 | | - | 17 arisingfromtheconductofofficialdutiesonbehalfofthestatebysaid |
|---|
| 2360 | | - | 18 employeeorsubcontractororforanyagencyofthestate; |
|---|
| 2361 | | - | 19 c.Acurrentstreamofincomefromanysourcewhatsoever,includinga |
|---|
| 2362 | | - | 20 salary,wages,disability,retirement,pension,insuranceorannuitybenefitsor |
|---|
| 2363 | | - | 21 similarpayments; |
|---|
| 2364 | | - | 22 (b)"Assets"shallnotinclude: |
|---|
| 2365 | | - | 23 a.Thehomesteadoftheoffenderuptofiftythousanddollarsinvalue; |
|---|
| 2366 | | - | 24 b.Moneysavedbytheoffenderfromwagesandbonusesuptotwo |
|---|
| 2367 | | - | 25 thousandfivehundreddollarspaidtheoffenderwhileheorshewasconfined |
|---|
| 2368 | | - | 26 toastatecorrectionalcenter; |
|---|
| 2369 | | - | 27 (2)"Costofcare",thecosttothedepartmentofcorrectionsfor |
|---|
| 2370 | | - | 28 providingtransportation,room,board,clothing,security,medical,andother |
|---|
| 2371 | | - | 29 normallivingexpensesofoffendersunderthejurisdictionofthedepartment, |
|---|
| 2372 | | - | 30 asdeterminedbythedirectorofthedepartment; |
|---|
| 2373 | | - | 31 (3)"Department",thedepartmentofcorrectionsofthisstate; |
|---|
| 2374 | | - | 32 (4)"Director",thedirectorofthedepartment; |
|---|
| 2375 | | - | 33 (5)"Offender",anypersonwhoisunderthejurisdictionofthe |
|---|
| 2376 | | - | 34 departmentandisconfinedinanystatecorrectionalcenterorisunderthe |
|---|
| 2377 | | - | 35 continuingjurisdictionofthedepartment; |
|---|
| 2378 | | - | 36 (6)"Statecorrectionalcenter",afacilityorinstitutionwhichhousesan |
|---|
| 2379 | | - | 37 offenderpopulationunderthejurisdictionofthedepartment.State |
|---|
| 2380 | | - | 38 correctionalcenterincludesacorrectionalcamp,communitycorrection |
|---|
| 2381 | | - | 39 center,honorcenter,orstateprison.] |
|---|
| 2382 | | - | [217.829.1.Thedepartmentshalldevelopaformwhichshallbeused |
|---|
| 2383 | | - | 2 bythedepartmenttoobtaininformationfromalloffendersregardingtheir |
|---|
| 2384 | | - | 3 assets. |
|---|
| 2385 | | - | 4 2.Theformshallbesubmittedtoeachoffenderasofthedatetheform |
|---|
| 2386 | | - | 5 isdevelopedandtoeveryoffenderwhothereafterissentencedto |
|---|
| 2387 | | - | 6 imprisonmentunderthejurisdictionofthedepartment.Theformmaybe |
|---|
| 2388 | | - | 7 resubmittedtoanoffenderbythedepartmentforpurposesofobtainingcurrent |
|---|
| 2389 | | - | 8 informationregardingassetsoftheoffender. |
|---|
| 2390 | | - | 9 3.Everyoffendershallcompletetheformorprovideforcompletionof |
|---|
| 2391 | | - | 10 theformandtheoffendershallswearoraffirmunderoaththattothebestof |
|---|
| 2392 | | - | SS#2SCSHCS#2HB495 64 11 hisorherknowledgetheinformationprovidediscompleteandaccurate.Any |
|---|
| 2393 | | - | 12 personwhoshallknowinglyprovidefalseinformationonsaidformtostate |
|---|
| 2394 | | - | 13 officialsoremployeesshallbeguiltyofthecrimeofmakingafalseaffidavit |
|---|
| 2395 | | - | 14 asprovidedbysection575.050. |
|---|
| 2396 | | - | 15 4.Failurebyanoffendertofully,adequatelyandcorrectlycomplete |
|---|
| 2397 | | - | 16 theformmaybeconsideredbytheparoleboardforpurposesofaparole |
|---|
| 2398 | | - | 17 determination,andindetermininganoffender'sparolereleasedateor |
|---|
| 2399 | | - | 18 eligibilityandshallconstitutesufficientgroundsfordenialofparole. |
|---|
| 2400 | | - | 19 5.Priortoreleaseofanyoffenderfromimprisonment,andagainprior |
|---|
| 2401 | | - | 20 toreleasefromthejurisdictionofthedepartment,thedepartmentshallrequest |
|---|
| 2402 | | - | 21 fromtheoffenderanassignmentoftenpercentofanywages,salary,benefits |
|---|
| 2403 | | - | 22 orpaymentsfromanysource.Suchanassignmentshallbevalidforthelonger |
|---|
| 2404 | | - | 23 periodoffiveyearsfromthedateofitsexecution,orfiveyearsfromthedate |
|---|
| 2405 | | - | 24 thattheoffenderisreleasedfromthejurisdictionofthedepartmentoranyof |
|---|
| 2406 | | - | 25 itsdivisionsoragencies.Theassignmentshallsecurepaymentofthetotalcost |
|---|
| 2407 | | - | 26 ofcareoftheoffenderexecutingtheassignment.Therestrictionsonthe |
|---|
| 2408 | | - | 27 maximumamountofearningssubjecttogarnishmentcontainedinsection |
|---|
| 2409 | | - | 28 525.030shallapplytoearningssubjecttoassignmentsexecutedpursuantto |
|---|
| 2410 | | - | 29 thissubsection.] |
|---|
| 2411 | | - | [217.831.1.Thedirectorshallforwardtotheattorneygeneralareport |
|---|
| 2412 | | - | 2 oneachoffendercontainingacompletedformpursuanttotheprovisionsof |
|---|
| 2413 | | - | 3 section217.829togetherwithallotherinformationavailableontheassetsof |
|---|
| 2414 | | - | 4 theoffenderandanestimateofthetotalcostofcareforthatoffender. |
|---|
| 2415 | | - | 5 2.Theattorneygeneralmayinvestigateorcausetobeinvestigatedall |
|---|
| 2416 | | - | 6 reportsfurnishedpursuanttotheprovisionsofsubsection1ofthissection. |
|---|
| 2417 | | - | 7 Thisinvestigationmayincludeseekinginformationfromanysourcethatmay |
|---|
| 2418 | | - | 8 haverelevantinformationconcerninganoffender'sassets.Thedirectorshall |
|---|
| 2419 | | - | 9 provideallinformationpossessedbythedepartmentanditsdivisionsand |
|---|
| 2420 | | - | 10 agencies,uponrequestoftheattorneygeneral,inordertoassisttheattorney |
|---|
| 2421 | | - | 11 generalincompletinghisdutiespursuanttosections217.825to217.841. |
|---|
| 2422 | | - | 12 3.Iftheattorneygeneraluponcompletingtheinvestigationunder |
|---|
| 2423 | | - | 13 subsection2ofthissectionhasgoodcausetobelievethatanoffenderor |
|---|
| 2424 | | - | 14 formeroffenderhassufficientassetstorecovernotlessthantenpercentofthe |
|---|
| 2425 | | - | 15 estimatedcostofcareoftheoffenderortenpercentoftheestimatedcostof |
|---|
| 2426 | | - | 16 careoftheoffenderfortwoyears,whicheverisless,orhasastreamofincome |
|---|
| 2427 | | - | 17 sufficienttopaysuchamountswithinafive-yearperiod,theattorneygeneral |
|---|
| 2428 | | - | 18 mayseektosecurereimbursementfortheexpenseofthestateofMissourifor |
|---|
| 2429 | | - | 19 thecostofcareofsuchoffenderorformeroffender. |
|---|
| 2430 | | - | 20 4.Theattorneygeneral,oranyprosecutingattorneyonbehalfofthe |
|---|
| 2431 | | - | 21 attorneygeneral,shallnotbringanactionpursuanttothissectionagainstan |
|---|
| 2432 | | - | 22 offenderorformeroffenderaftertheexpirationoffiveyearsafterhisrelease |
|---|
| 2433 | | - | 23 fromthejurisdictionofthedepartment.] |
|---|
| 2434 | | - | [217.833.1.Notmorethanninetypercentofthevalueoftheassetsof |
|---|
| 2435 | | - | 2 theoffendermaybeusedforpurposesofsecuringcostsandreimbursement |
|---|
| 2436 | | - | 3 pursuanttotheprovisionsofsections217.825to217.841. |
|---|
| 2437 | | - | SS#2SCSHCS#2HB495 65 4 2.Theamountofreimbursementsoughtfromanoffendershallnotbe |
|---|
| 2438 | | - | 5 inexcessofthepercapitacostforcareformaintainingoffendersinthestate |
|---|
| 2439 | | - | 6 correctionalcenterinwhichtheoffenderishousedfortheperiodorperiods |
|---|
| 2440 | | - | 7 suchoffenderisanoffenderinastatecorrectionalcenter.] |
|---|
| 2441 | | - | [217.835.1.Thecircuitcourtshallhaveexclusivejurisdictionoverall |
|---|
| 2442 | | - | 2 proceedingsseekingreimbursementfromoffenderspursuanttotheprovisions |
|---|
| 2443 | | - | 3 ofsections217.825to217.841.Theattorneygeneralmayfileacomplaintin |
|---|
| 2444 | | - | 4 thecircuitcourtforthecountyorcityfromwhichaprisonerwassentencedor |
|---|
| 2445 | | - | 5 inthecircuitcourtinthecountyorcityoftheofficeofthedirectorofthe |
|---|
| 2446 | | - | 6 department,againstanypersonunderthejurisdictionofthedepartmentstating |
|---|
| 2447 | | - | 7 thatthepersonisorhasbeenanoffenderinastatecorrectionalcenter,that |
|---|
| 2448 | | - | 8 thereisgoodcausetobelievethatthepersonhasassets,andprayingthatthe |
|---|
| 2449 | | - | 9 assetsbeusedtoreimbursethestatefortheexpensesincurredortobe |
|---|
| 2450 | | - | 10 incurred,orboth,bythestateforthecostofcareofthepersonasanoffender. |
|---|
| 2451 | | - | 11 2.Uponthefilingofthecomplaintundersubsection1ofthissection, |
|---|
| 2452 | | - | 12 thecourtshallissueanordertoshowcausewhytheprayerofthecomplainant |
|---|
| 2453 | | - | 13 shouldnotbegranted.Thecomplaintandordershallbeserveduponthe |
|---|
| 2454 | | - | 14 personpersonally,or,ifthepersonisconfinedinastatecorrectionalcenter,by |
|---|
| 2455 | | - | 15 registeredmailaddressedtothepersonincareofthechiefadministratorofthe |
|---|
| 2456 | | - | 16 statecorrectionalcenterwherethepersonishoused,atleastthirtydaysbefore |
|---|
| 2457 | | - | 17 thedateofhearingonthecomplaintandorder. |
|---|
| 2458 | | - | 18 3.Atthetimeofthehearingonthecomplaintandorder,ifitappears |
|---|
| 2459 | | - | 19 thatthepersonhasanyassetswhichoughttobesubjectedtotheclaimofthe |
|---|
| 2460 | | - | 20 statepursuanttotheprovisionsofsections217.825to217.841,thecourtshall |
|---|
| 2461 | | - | 21 issueanorderrequiringanyperson,corporation,orotherlegalentity |
|---|
| 2462 | | - | 22 possessedorhavingcustodyofsuchassets,toappropriateandapplysuch |
|---|
| 2463 | | - | 23 assetsoraportionthereoftosatisfysuchclaim. |
|---|
| 2464 | | - | 24 4.Atthehearingonthecomplaintandorderandbeforeenteringany |
|---|
| 2465 | | - | 25 orderonbehalfofthestateagainstthedefendant,thecourtshalltakeinto |
|---|
| 2466 | | - | 26 considerationanylegalobligationofthedefendanttosupportaspouse,minor |
|---|
| 2467 | | - | 27 children,orotherdependentsandanymoralobligationtosupportdependents |
|---|
| 2468 | | - | 28 towhomthedefendantisprovidingorhasinfactprovidedsupport. |
|---|
| 2469 | | - | 29 5.Iftheperson,corporation,orotherlegalentityshallneglector |
|---|
| 2470 | | - | 30 refusetocomplywithanorderissuedpursuanttosubsection3ofthissection, |
|---|
| 2471 | | - | 31 thecourtshallordertheperson,corporation,orotherlegalentitytoappear |
|---|
| 2472 | | - | 32 beforethecourtatsuchtimeasthecourtmaydirectandtoshowcausewhythe |
|---|
| 2473 | | - | 33 person,corporation,orotherlegalentityshouldnotbeconsideredincontempt |
|---|
| 2474 | | - | 34 ofcourt. |
|---|
| 2475 | | - | 35 6.If,intheopinionofthecourt,theassetsoftheprisoneraresufficient |
|---|
| 2476 | | - | 36 topaythecostoftheproceedingsundertakenpursuanttotheprovisionsof |
|---|
| 2477 | | - | 37 sections217.825to217.841,theprisonershallbeliableforthosecostsupon |
|---|
| 2478 | | - | 38 orderofthecourt.] |
|---|
| 2479 | | - | [217.837.1.Exceptasprovidedinsubsection3ofthissection,the |
|---|
| 2480 | | - | 2 attorneygeneralmayuseanyremedy,interimorder,orenforcementprocedure |
|---|
| 2481 | | - | 3 allowedbylaworcourtruleincludinganexparterestrainingordertorestrain |
|---|
| 2482 | | - | 4 theprisoneroranyotherpersonorlegalentityinpossessionorhavingcustody |
|---|
| 2483 | | - | SS#2SCSHCS#2HB495 66 5 oftheestateoftheprisonerfromdisposingofcertainpropertyinavoidanceof |
|---|
| 2484 | | - | 6 anorderissuedpursuanttotheprovisionsofsection217.835. |
|---|
| 2485 | | - | 7 2.Toprotectandmaintainassetspendingresolutionofproceedings |
|---|
| 2486 | | - | 8 initiatedpursuanttotheprovisionsofsection217.835,thecourt,uponrequest, |
|---|
| 2487 | | - | 9 mayappointareceiver. |
|---|
| 2488 | | - | 10 3.Theattorneygeneraloraprosecutingattorneyshallnotenforceany |
|---|
| 2489 | | - | 11 judgmentobtainedpursuanttotheprovisionsofsection217.835bymeansof |
|---|
| 2490 | | - | 12 executionagainstthehomesteadoftheprisoner. |
|---|
| 2491 | | - | 13 4.Thestate'srighttorecoverthecostofincarcerationpursuanttoan |
|---|
| 2492 | | - | 14 orderissuedpursuanttotheprovisionsofsection217.835shallhavepriority |
|---|
| 2493 | | - | 15 overallotherliens,debts,orotherincumbrancesagainstrealpropertyorany |
|---|
| 2494 | | - | 16 otherassetswhicharepartofaprisoner'sestate.] |
|---|
| 2495 | | - | [217.839.1.Theattorneygeneralofthisstateshallenforcethe |
|---|
| 2496 | | - | 2 provisionsofsections217.825to217.841,exceptthattheattorneygeneral |
|---|
| 2497 | | - | 3 mayrequesttheprosecutingattorneyofthecountyorcityinwhichthe |
|---|
| 2498 | | - | 4 offenderwassentencedortheprosecutingattorneyofthecountyorcityin |
|---|
| 2499 | | - | 5 whichanyassetofanoffenderislocatedtomakeaninvestigationorassistin |
|---|
| 2500 | | - | 6 legalproceedingsundertakenpursuanttotheprovisionsofsections217.825to |
|---|
| 2501 | | - | 7 217.841. |
|---|
| 2502 | | - | 8 2.Thesentencingjudge,thesheriff,thecountyorcity,thechief |
|---|
| 2503 | | - | 9 administratorofthestatecorrectionalcenter,andthestatetreasurershall |
|---|
| 2504 | | - | 10 furnishtotheattorneygeneralorprosecutingattorneyallinformationand |
|---|
| 2505 | | - | 11 assistancepossibletoenabletheattorneygeneralorprosecutingattorneyto |
|---|
| 2506 | | - | 12 securereimbursementforthestatepursuanttotheprovisionsofsections |
|---|
| 2507 | | - | 13 217.825to217.841. |
|---|
| 2508 | | - | 14 3.Notwithstandingtheprovisionsofanyotherlawprotectingthe |
|---|
| 2509 | | - | 15 confidentialityofanyinformationpossessedbythestate,itsofficialsand |
|---|
| 2510 | | - | 16 agencies,thesecretaryofstate,thedirectorofthedepartmentofrevenue,the |
|---|
| 2511 | | - | 17 directorofthedepartmentofsocialservices,thedirectorofthedepartmentof |
|---|
| 2512 | | - | 18 corrections,thedirectorofthedepartmentoflaborandindustrialrelations,the |
|---|
| 2513 | | - | 19 directorofthedepartmentofpublicsafety,andthecommissionerof |
|---|
| 2514 | | - | 20 administration,andeachdivisionoragencywithinorassignedtosuch |
|---|
| 2515 | | - | 21 departments,shallprovidetheattorneygeneralorprosecutingattorneywithall |
|---|
| 2516 | | - | 22 informationrequestedpursuanttotheprovisionsofsections217.825to |
|---|
| 2517 | | - | 23 217.841. |
|---|
| 2518 | | - | 24 4.Anycountyormunicipalofficialhavingcustodyofrecordsofthe |
|---|
| 2519 | | - | 25 estateorrealpropertyofanyoffenderorformeroffendershallsurrendersaid |
|---|
| 2520 | | - | 26 recordsorcertifiedcopiesthereofwithoutfeetotheattorneygeneralor |
|---|
| 2521 | | - | 27 prosecutingattorneywhorequestsuchrecordspursuanttotheprovisionsof |
|---|
| 2522 | | - | 28 sections217.825to217.841.] |
|---|
| 2523 | | - | [217.841.1.Thecostsofanyinvestigationsshallbepaidfromthe |
|---|
| 2524 | | - | 2 reimbursementssecuredpursuanttotheprovisionsofsections217.825to |
|---|
| 2525 | | - | 3 217.841.Theinvestigativecostsshallbepresumedtobetwentypercentofthe |
|---|
| 2526 | | - | 4 reimbursementsrecovered,unlesstheattorneygeneralshalldemonstratetothe |
|---|
| 2527 | | - | 5 courtotherwise.Allreimbursementscollectedshallbepaidtothe"Inmate |
|---|
| 2528 | | - | 6 IncarcerationReimbursementActRevolvingFund",whichishereby |
|---|
| 2529 | | - | SS#2SCSHCS#2HB495 67 7 establishedinthestatetreasury.Moneysintheinmateincarceration |
|---|
| 2530 | | - | 8 reimbursementactrevolvingfundshallbeappropriatedtotheattorneygeneral |
|---|
| 2531 | | - | 9 inordertodefraythecostsoftheattorneygeneralinconnectionwithhisduties |
|---|
| 2532 | | - | 10 providedbysections217.825to217.841;andallremainingbalancesshallbe |
|---|
| 2533 | | - | 11 appropriatedtothedepartmentforpurposesofconstructionandoperationof |
|---|
| 2534 | | - | 12 statecorrectionalfacilities.Theprovisionsofsection33.080notwithstanding, |
|---|
| 2535 | | - | 13 moneysintheinmateincarcerationreimbursementactrevolvingfundshallnot |
|---|
| 2536 | | - | 14 lapse,betransferredorappropriatedtoorplacedtothecreditofthegeneral |
|---|
| 2537 | | - | 15 revenuefundoranyotherfundofthestate. |
|---|
| 2538 | | - | 16 2.Thestatetreasurermaydeterminetheamountduethestateforthe |
|---|
| 2539 | | - | 17 costofcareofanoffenderandrenderstatementsthereofandsuchsworn |
|---|
| 2540 | | - | 18 statementsshallbeconsideredprimafacieevidenceoftheamountdue.] |
|---|
| 2541 | | - | [574.050.1.Apersoncommitstheoffenseofriotingifheorshe |
|---|
| 2542 | | - | 2 knowinglyassembleswithsixormoreotherpersonsandagreeswithsuch |
|---|
| 2543 | | - | 3 personstoviolateanyofthecriminallawsofthisstateoroftheUnitedStates |
|---|
| 2544 | | - | 4 withforceorviolence,andthereafter,whilestillsoassembled,doesviolate |
|---|
| 2545 | | - | 5 anyofsaidlawswithforceorviolence. |
|---|
| 2546 | | - | 6 2.TheoffenseofriotingisaclassAmisdemeanor.] |
|---|
| 2547 | | - | SectionB.Inordertoensurethecontinuedoperationofapoliceforceinthecityof |
|---|
| 2548 | | - | 2St.LouisforthesafetyandwellbeingofthecitizensofthecityofSt.Louis,therepealof |
|---|
| 2549 | | - | 3sections84.175,84.240,84.341,84.342,84.343,84.344,84.345,84.346,and84.347,the |
|---|
| 2550 | | - | 4repealandreenactmentofsections84.020,84.030,84.100,84.150,84.160,84.170and |
|---|
| 2551 | | - | 5105.726,andtheenactmentofsections84.225and84.325ofthisactisdeemednecessaryfor |
|---|
| 2552 | | - | 6theimmediatepreservationofthepublichealth,welfare,peace,andsafety,andishereby |
|---|
| 2553 | | - | 7declaredtobeanemergencyactwithinthemeaningoftheconstitution,andtherepealof |
|---|
| 2554 | | - | 8sections84.175,84.240,84.341,84.342,84.343,84.344,84.345,84.346,and84.347,the |
|---|
| 2555 | | - | 9repealandreenactmentofsections84.020,84.030,84.100,84.150,84.160,84.170and |
|---|
| 2556 | | - | 10105.726,andtheenactmentofsections84.225and84.325ofthisactshallbeinfullforceand |
|---|
| 2557 | | - | 11effectuponitspassageandapproval. |
|---|
| 2558 | | - | âś” |
|---|
| 2559 | | - | SS#2SCSHCS#2HB495 68 |
|---|
| 1186 | + | with the municipal police depa rtment, as well as all accrued 42 |
|---|
| 1187 | + | years of service that such commissioned and civilian 43 |
|---|
| 1188 | + | personnel had previously with the board of police 44 |
|---|
| 1189 | + | commissioners. Such personnel shall be entitled to the same 45 |
|---|
| 1190 | + | holidays, vacation, sick leave, sick bonus time, and annu al 46 |
|---|
| 1191 | + | step-increases they were entitled to as employees of the 47 |
|---|
| 1192 | + | municipal police department. 48 |
|---|
| 1193 | + | 5. The commissioned and civilian personnel who retire 49 |
|---|
| 1194 | + | from service with the municipal police department before the 50 |
|---|
| 1195 | + | board of police commissioners assumed cont rol of the 51 |
|---|
| 1196 | + | department under subsection 1 of this section shall continue 52 |
|---|
| 1197 | + | to be entitled to the same pension benefits provided as 53 |
|---|
| 1198 | + | employees of the municipal police department and the same 54 |
|---|
| 1199 | + | benefits set forth in subsection 4 of this section. Any 55 |
|---|
| 1200 | + | police pension system created under chapter 86 for the 56 |
|---|
| 1201 | + | benefit of a police force established under sections 84.012 57 |
|---|
| 1202 | + | to 84.340 shall continue to be governed by chapter 86 and 58 |
|---|
| 1203 | + | shall apply to any comprehensive policing plan and any 59 |
|---|
| 1204 | + | police force established under s ections 84.012 to 84.340. 60 |
|---|
| 1205 | + | Other than any provision that makes chapter 86 applicable to 61 |
|---|
| 1206 | + | a municipal police force established under sections 84.343 62 |
|---|
| 1207 | + | to 84.346, nothing in sections 84.012 to 84.340 shall be 63 |
|---|
| 1208 | + | construed as limiting or changing the rights or benefits 64 |
|---|
| 1209 | + | provided under chapter 86. 65 |
|---|
| 1210 | + | 6. The board of police commissioners may promulgate 66 |
|---|
| 1211 | + | all necessary rules and regulations for the implementation 67 |
|---|
| 1212 | + | and administration of this section. Any rule or portion of 68 |
|---|
| 1213 | + | a rule, as that term is defined in sect ion 536.010, that is 69 |
|---|
| 1214 | + | created under the authority delegated in this section shall 70 |
|---|
| 1215 | + | become effective only if it complies with and is subject to 71 |
|---|
| 1216 | + | all of the provisions of chapter 536 and, if applicable, 72 |
|---|
| 1217 | + | section 536.028. This section and chapter 536 are 73 |
|---|
| 1218 | + | nonseverable and if any of the powers vested with the 74 |
|---|
| 1219 | + | 37 |
|---|
| 1220 | + | general assembly pursuant to chapter 536 to review, to delay 75 |
|---|
| 1221 | + | the effective date, or to disapprove and annul a rule are 76 |
|---|
| 1222 | + | subsequently held unconstitutional, then the grant of 77 |
|---|
| 1223 | + | rulemaking authority and an y rule proposed or adopted after 78 |
|---|
| 1224 | + | the effective date of this section shall be invalid and void. 79 |
|---|
| 1225 | + | 105.726. 1. Nothing in sections 105.711 to 105.726 1 |
|---|
| 1226 | + | shall be construed to broaden the liability of the state of 2 |
|---|
| 1227 | + | Missouri beyond the prov isions of sections 537.600 to 3 |
|---|
| 1228 | + | 537.610, nor to abolish or waive any defense at law which 4 |
|---|
| 1229 | + | might otherwise be available to any agency, officer, or 5 |
|---|
| 1230 | + | employee of the state of Missouri. Sections 105.711 to 6 |
|---|
| 1231 | + | 105.726 do not waive the sovereign immunity of the s tate of 7 |
|---|
| 1232 | + | Missouri. 8 |
|---|
| 1233 | + | 2. The creation of the state legal expense fund and 9 |
|---|
| 1234 | + | the payment therefrom of such amounts as may be necessary 10 |
|---|
| 1235 | + | for the benefit of any person covered thereby are deemed 11 |
|---|
| 1236 | + | necessary and proper public purposes for which funds of this 12 |
|---|
| 1237 | + | state may be expended. 13 |
|---|
| 1238 | + | 3. Moneys in the state legal expense fund shall not be 14 |
|---|
| 1239 | + | available for the payment of any claim or any amount 15 |
|---|
| 1240 | + | required by any final judgment rendered by a court of 16 |
|---|
| 1241 | + | competent jurisdiction against a board of police 17 |
|---|
| 1242 | + | commissioners established under chapter 84, including the 18 |
|---|
| 1243 | + | commissioners, any police officer, notwithstanding sections 19 |
|---|
| 1244 | + | 84.330 and 84.710, or other provisions of law, other 20 |
|---|
| 1245 | + | employees, agents, representative, or any other individual 21 |
|---|
| 1246 | + | or entity acting or purporting to act on its or their 22 |
|---|
| 1247 | + | behalf. Such was the intent of the general assembly in the 23 |
|---|
| 1248 | + | original enactment of sections 105.711 to 105.726, and it is 24 |
|---|
| 1249 | + | made express by this section in light of the decision in 25 |
|---|
| 1250 | + | Wayman Smith, III, et al. v. State of Missouri, 152 S .W.3d 26 |
|---|
| 1251 | + | 275. Except that the commissioner of administration shall 27 |
|---|
| 1252 | + | reimburse from the legal expense fund the [board] boards of 28 |
|---|
| 1253 | + | 38 |
|---|
| 1254 | + | police commissioners established under [section 84.350, and 29 |
|---|
| 1255 | + | any successor-in-interest established pursuant to section 30 |
|---|
| 1256 | + | 84.344,] chapter 84 for liability claims otherwise eligible 31 |
|---|
| 1257 | + | for payment under section 105.711 paid by such [board] 32 |
|---|
| 1258 | + | boards on an equal share basis per claim up to a maximum of 33 |
|---|
| 1259 | + | [one] two million dollars per fiscal year. 34 |
|---|
| 1260 | + | 4. [Subject to the provisions of subs ection 2 of 35 |
|---|
| 1261 | + | section 84.345,] If the representation of the attorney 36 |
|---|
| 1262 | + | general is requested by a board of police commissioners [or 37 |
|---|
| 1263 | + | its successor-in-interest established pursuant to section 38 |
|---|
| 1264 | + | 84.344], the attorney general shall represent, investigate, 39 |
|---|
| 1265 | + | defend, negotiate, or compromise all claims under sections 40 |
|---|
| 1266 | + | 105.711 to 105.726 for the board of police commissioners, 41 |
|---|
| 1267 | + | [its successor-in-interest pursuant to section 84.344, ] any 42 |
|---|
| 1268 | + | police officer, other employees, agents, representatives, or 43 |
|---|
| 1269 | + | any other individual or entity acting or purporting to act 44 |
|---|
| 1270 | + | on their behalf. The attorney general may establish 45 |
|---|
| 1271 | + | procedures by rules promulgated under chapter 536 under 46 |
|---|
| 1272 | + | which claims must be referred for the attorney general's 47 |
|---|
| 1273 | + | representation. The attorney general and the o fficials of 48 |
|---|
| 1274 | + | the city which the police board represents [or represented] 49 |
|---|
| 1275 | + | shall meet and negotiate reasonable expenses or charges that 50 |
|---|
| 1276 | + | will fairly compensate the attorney general and the office 51 |
|---|
| 1277 | + | of administration for the cost of the representation of the 52 |
|---|
| 1278 | + | claims under this section. 53 |
|---|
| 1279 | + | 5. Claims tendered to the attorney general promptly 54 |
|---|
| 1280 | + | after the claim was asserted as required by section 105.716 55 |
|---|
| 1281 | + | and prior to August 28, 2005, may be investigated, defended, 56 |
|---|
| 1282 | + | negotiated, or compromised by the attorney gen eral and full 57 |
|---|
| 1283 | + | payments may be made from the state legal expense fund on 58 |
|---|
| 1284 | + | behalf of the entities and individuals described in this 59 |
|---|
| 1285 | + | section as a result of the holding in Wayman Smith, III, et 60 |
|---|
| 1286 | + | al. v. State of Missouri, 152 S.W.3d 275. 61 |
|---|
| 1287 | + | 39 |
|---|
| 1288 | + | 191.1005. 1. No individual or entity shall knowingly 1 |
|---|
| 1289 | + | open, lease, rent, own, use, maintain, manage, operate, or 2 |
|---|
| 1290 | + | control a public or private facility, site, or building for 3 |
|---|
| 1291 | + | the purpose, in part or in whole, of allowing individuals to 4 |
|---|
| 1292 | + | self-administer preobtained controlled substances, the 5 |
|---|
| 1293 | + | possession of which by the individual is punishable under 6 |
|---|
| 1294 | + | section 579.015 and is not otherwise authorized by chapters 7 |
|---|
| 1295 | + | 195 and 579. 8 |
|---|
| 1296 | + | 2. This section shall not apply to any health care 9 |
|---|
| 1297 | + | facility licensed pursuant to chapter 197 or 198 that: 10 |
|---|
| 1298 | + | (a) Provides medical assistance or monitoring to 11 |
|---|
| 1299 | + | individuals who have self -administered controlled substances; 12 |
|---|
| 1300 | + | (b) Provides sterile injection supplies; 13 |
|---|
| 1301 | + | (c) Collects used hypodermic needles and syringes; or 14 |
|---|
| 1302 | + | (d) Provides secure hypodermic needle and syringe 15 |
|---|
| 1303 | + | disposal services. 16 |
|---|
| 1304 | + | 3. This section shall not affect the immunity from 17 |
|---|
| 1305 | + | liability provided by section 195.205 for any individual 18 |
|---|
| 1306 | + | who, in good faith, seeks or obtains medical assistance for 19 |
|---|
| 1307 | + | someone who is experiencing an overdose of a controlled 20 |
|---|
| 1308 | + | substance or for any individual experiencing an overdose of 21 |
|---|
| 1309 | + | a controlled substance who seeks medical assistance for 22 |
|---|
| 1310 | + | himself or herself or is the subject of a good faith request 23 |
|---|
| 1311 | + | for medical assistance f or an overdose of a controlled 24 |
|---|
| 1312 | + | substance. 25 |
|---|
| 1313 | + | 4. As used in this section, the term "controlled 26 |
|---|
| 1314 | + | substance" means a drug, substance, or immediate precursor 27 |
|---|
| 1315 | + | in Schedules I through V listed in chapter 195. 28 |
|---|
| 1316 | + | 217.451. No correctional center or other party shall 1 |
|---|
| 1317 | + | charge an offender in a correctional center a total amount 2 |
|---|
| 1318 | + | for a domestic phone call, including fees and any per -minute 3 |
|---|
| 1319 | + | rate, that exceeds the equivalent of twelve cents per minute. 4 |
|---|
| 1320 | + | 40 |
|---|
| 1321 | + | 221.108. 1. Jails shall provide inmates with 1 |
|---|
| 1322 | + | reasonable access to phone services during an inmate's term 2 |
|---|
| 1323 | + | of confinement, except phone access may be restricted as a 3 |
|---|
| 1324 | + | disciplinary measure. 4 |
|---|
| 1325 | + | 2. No jail or other party shall charge an inmate in a 5 |
|---|
| 1326 | + | jail a total amount for a do mestic phone call, including 6 |
|---|
| 1327 | + | fees and any per-minute rate, that exceeds the equivalent of 7 |
|---|
| 1328 | + | twelve cents per minute. 8 |
|---|
| 1329 | + | 221.520. 1. As used in this section, the following 1 |
|---|
| 1330 | + | terms mean: 2 |
|---|
| 1331 | + | (1) "Extraordinary circumstance", a substantia l flight 3 |
|---|
| 1332 | + | risk or some other extraordinary medical or security 4 |
|---|
| 1333 | + | circumstance that dictates restraints be used to ensure the 5 |
|---|
| 1334 | + | safety and security of a pregnant offender in her third 6 |
|---|
| 1335 | + | trimester or a postpartum offender within forty -eight hours 7 |
|---|
| 1336 | + | postdelivery, the staff of the county or city jail or 8 |
|---|
| 1337 | + | medical facility, other offenders, or the public; 9 |
|---|
| 1338 | + | (2) "Labor", the period of time before a birth during 10 |
|---|
| 1339 | + | which contractions are present; 11 |
|---|
| 1340 | + | (3) "Postpartum", the period of recovery immediately 12 |
|---|
| 1341 | + | following childbirth, which is six weeks for a vaginal birth 13 |
|---|
| 1342 | + | or eight weeks for a cesarean birth, or longer if so 14 |
|---|
| 1343 | + | determined by a physician or nurse; 15 |
|---|
| 1344 | + | (4) "Restraints", any device used to control the 16 |
|---|
| 1345 | + | movement of a person's body or limbs. 17 |
|---|
| 1346 | + | 2. Except in extraordinary circumstances, a county or 18 |
|---|
| 1347 | + | city jail shall not use restraints on a pregnant offender in 19 |
|---|
| 1348 | + | her third trimester, whether during transportation to and 20 |
|---|
| 1349 | + | from visits to health care providers and court proceedings, 21 |
|---|
| 1350 | + | during medical appointments and ex aminations, or during 22 |
|---|
| 1351 | + | labor, delivery, or forty -eight hours postdelivery. 23 |
|---|
| 1352 | + | 3. Pregnant offenders shall be transported in vehicles 24 |
|---|
| 1353 | + | equipped with seatbelts. 25 |
|---|
| 1354 | + | 41 |
|---|
| 1355 | + | 4. In the event a sheriff or jailer determines that 26 |
|---|
| 1356 | + | extraordinary circumstances exist a nd restraints are 27 |
|---|
| 1357 | + | necessary, the sheriff or jailer shall fully document in 28 |
|---|
| 1358 | + | writing within forty -eight hours of the incident the reasons 29 |
|---|
| 1359 | + | he or she determined such extraordinary circumstances 30 |
|---|
| 1360 | + | existed, the type of restraints used, and the reasons those 31 |
|---|
| 1361 | + | restraints were considered reasonable under the 32 |
|---|
| 1362 | + | circumstances. Such documents shall be kept on file by the 33 |
|---|
| 1363 | + | county or city jail for at least five years from the date 34 |
|---|
| 1364 | + | the restraints were used. 35 |
|---|
| 1365 | + | 5. Any time restraints are used on a pregnant offender 36 |
|---|
| 1366 | + | in her third trimester or on a postpartum offender within 37 |
|---|
| 1367 | + | forty-eight hours postdelivery, the restraints shall be 38 |
|---|
| 1368 | + | reasonable under the circumstances. Except in extraordinary 39 |
|---|
| 1369 | + | circumstances, no leg, ankle, or waist restraints or any 40 |
|---|
| 1370 | + | mechanical restraint s shall be used on any such offender, 41 |
|---|
| 1371 | + | and, if wrist restraints are used, such restraints shall be 42 |
|---|
| 1372 | + | placed in the front of such offender's body to protect the 43 |
|---|
| 1373 | + | offender and the unborn child in the case of a forward fall. 44 |
|---|
| 1374 | + | 6. The county or city jail sh all: 45 |
|---|
| 1375 | + | (1) Ensure that employees of the jail are provided 46 |
|---|
| 1376 | + | with training, which may include online training, on the 47 |
|---|
| 1377 | + | provisions of this section; and 48 |
|---|
| 1378 | + | (2) Inform female offenders, in writing and orally, of 49 |
|---|
| 1379 | + | any policies and practices developed in a ccordance with this 50 |
|---|
| 1380 | + | section upon admission to the jail, and post the policies 51 |
|---|
| 1381 | + | and practices in locations in the jail where such notices 52 |
|---|
| 1382 | + | are commonly posted and will be seen by female offenders. 53 |
|---|
| 1383 | + | 221.523. 1. By January 1, 2026, all county and city 1 |
|---|
| 1384 | + | jails shall develop specific procedures for the intake and 2 |
|---|
| 1385 | + | care of offenders who are pregnant, which shall include 3 |
|---|
| 1386 | + | procedures regarding: 4 |
|---|
| 1387 | + | (1) Maternal health evaluations; 5 |
|---|
| 1388 | + | 42 |
|---|
| 1389 | + | (2) Dietary supplements, including prenatal vitamins; 6 |
|---|
| 1390 | + | (3) Timely and regular nutritious meals, consistent 7 |
|---|
| 1391 | + | with the Nutrition During Pregnancy Guidelines prepared by 8 |
|---|
| 1392 | + | the American College of Obstetricians and Gynecologists; 9 |
|---|
| 1393 | + | (4) Substance abuse treatment; 10 |
|---|
| 1394 | + | (5) Treatment for the human immunodefi ciency virus and 11 |
|---|
| 1395 | + | ways to avoid human immunodeficiency virus transmission; 12 |
|---|
| 1396 | + | (6) Hepatitis C; 13 |
|---|
| 1397 | + | (7) Sleeping arrangements for such pregnant offenders 14 |
|---|
| 1398 | + | in the third trimester, including requiring such offenders 15 |
|---|
| 1399 | + | to sleep on the bottom bunk bed; 16 |
|---|
| 1400 | + | (8) Access to mental health professionals; 17 |
|---|
| 1401 | + | (9) Sanitary materials; and 18 |
|---|
| 1402 | + | (10) Postpartum recovery, including that, except in 19 |
|---|
| 1403 | + | extraordinary circumstances, no such offender shall be 20 |
|---|
| 1404 | + | placed in isolation during such recovery. 21 |
|---|
| 1405 | + | 2. As used in this section, the term "postpartum 22 |
|---|
| 1406 | + | recovery" means, as determined by a physician, the period 23 |
|---|
| 1407 | + | immediately following delivery, including the entire period 24 |
|---|
| 1408 | + | an offender who was pregnant is in the hospital or infirmary 25 |
|---|
| 1409 | + | after delivery. 26 |
|---|
| 1410 | + | 304.012. 1. Every person operating a motor vehicle on 1 |
|---|
| 1411 | + | the roads and highways of this state shall drive the vehicle 2 |
|---|
| 1412 | + | in a careful and prudent manner and at a rate of speed so as 3 |
|---|
| 1413 | + | not to endanger the property of another or the life or limb 4 |
|---|
| 1414 | + | of any person and shall exercise the highest degree of care. 5 |
|---|
| 1415 | + | 2. No person operating a motor vehicle on the roads 6 |
|---|
| 1416 | + | and highways of this state shall perform stunt driving, as 7 |
|---|
| 1417 | + | such term is defined in section 304.145. 8 |
|---|
| 1418 | + | 3. Any person who violates the provisions of this 9 |
|---|
| 1419 | + | section is guilty of a class B misdemeanor, unless an 10 |
|---|
| 1420 | + | accident is involved then it shall be a class A misdemeanor. 11 |
|---|
| 1421 | + | 43 |
|---|
| 1422 | + | 304.145. 1. As used in this section, the following 1 |
|---|
| 1423 | + | terms mean: 2 |
|---|
| 1424 | + | (1) "Aggravated offender", a person who has been found 3 |
|---|
| 1425 | + | guilty of: 4 |
|---|
| 1426 | + | (a) Three or more violations of this section committed 5 |
|---|
| 1427 | + | on separate occasions; or 6 |
|---|
| 1428 | + | (b) Two or more violations of this section committed 7 |
|---|
| 1429 | + | on separate occasions where at least one of the violations 8 |
|---|
| 1430 | + | the defendant was ope rating a vehicle and another person was 9 |
|---|
| 1431 | + | injured or killed; 10 |
|---|
| 1432 | + | (2) "Burnout", a maneuver performed while operating a 11 |
|---|
| 1433 | + | motor vehicle whereby the wheels of the motor vehicle are 12 |
|---|
| 1434 | + | spun, resulting in friction causing the motor vehicle's 13 |
|---|
| 1435 | + | tires to heat up and emit smoke; 14 |
|---|
| 1436 | + | (3) "Chronic offender", a person who has been found 15 |
|---|
| 1437 | + | guilty of: 16 |
|---|
| 1438 | + | (a) Four or more violations of this section committed 17 |
|---|
| 1439 | + | on separate occasions; or 18 |
|---|
| 1440 | + | (b) Three or more violations of this section committed 19 |
|---|
| 1441 | + | on separate occasions w here at least one of the violations 20 |
|---|
| 1442 | + | the defendant was operating a vehicle and another person was 21 |
|---|
| 1443 | + | injured or killed; or 22 |
|---|
| 1444 | + | (c) Two or more violations of this section committed 23 |
|---|
| 1445 | + | on separate occasions where both of the violations the 24 |
|---|
| 1446 | + | defendant was operating a vehicle and another person was 25 |
|---|
| 1447 | + | injured or killed; 26 |
|---|
| 1448 | + | (4) "Donut", a motor vehicle maneuver in which the 27 |
|---|
| 1449 | + | front or rear of the motor vehicle is rotated around the 28 |
|---|
| 1450 | + | opposite set of wheels in a motion that may cause a curved 29 |
|---|
| 1451 | + | skid-mark pattern of rubber on the driving surface, or the 30 |
|---|
| 1452 | + | tires to heat up and emit smoke, or both; 31 |
|---|
| 1453 | + | (5) "Drag race", the operation of two or more motor 32 |
|---|
| 1454 | + | vehicles from a point side by side in a competitive attempt 33 |
|---|
| 1455 | + | 44 |
|---|
| 1456 | + | to outgain or outdistance each other, or the operation o f 34 |
|---|
| 1457 | + | one or more motor vehicles over a common selected course, 35 |
|---|
| 1458 | + | for the purpose of comparing the relative speeds, power, or 36 |
|---|
| 1459 | + | acceleration of such motor vehicles within a certain 37 |
|---|
| 1460 | + | distance or time limit; 38 |
|---|
| 1461 | + | (6) "Drifting", a motor vehicle maneuver in which the 39 |
|---|
| 1462 | + | motor vehicle is steered so that it makes a controlled skid 40 |
|---|
| 1463 | + | sideways through a turn with the front wheels oriented in a 41 |
|---|
| 1464 | + | direction opposite the turn; 42 |
|---|
| 1465 | + | (7) "Habitual offender", a person who has been found 43 |
|---|
| 1466 | + | guilty of: 44 |
|---|
| 1467 | + | (a) Five or more violations of this section committed 45 |
|---|
| 1468 | + | on separate occasions; 46 |
|---|
| 1469 | + | (b) Four or more violations of this section committed 47 |
|---|
| 1470 | + | on separate occasions where at least one of the violations 48 |
|---|
| 1471 | + | the defendant was operating a vehicle and another person was 49 |
|---|
| 1472 | + | injured or killed; or 50 |
|---|
| 1473 | + | (c) Three or more violations of this section committed 51 |
|---|
| 1474 | + | on separate occasions where at least two of the violations 52 |
|---|
| 1475 | + | the defendant was operating a vehicle and another person was 53 |
|---|
| 1476 | + | injured or killed; 54 |
|---|
| 1477 | + | (8) "Highway", any public thoroughfare for vehicles, 55 |
|---|
| 1478 | + | including state roads, county roads and public streets, 56 |
|---|
| 1479 | + | avenues, boulevards, parkways, or alleys in any municipality; 57 |
|---|
| 1480 | + | (9) "Persistent offender", a person who has been found 58 |
|---|
| 1481 | + | guilty of: 59 |
|---|
| 1482 | + | (a) Two or more violations of this section com mitted 60 |
|---|
| 1483 | + | on separate occasions; or 61 |
|---|
| 1484 | + | (b) One violation of this section where the defendant 62 |
|---|
| 1485 | + | was operating a vehicle and another person was injured or 63 |
|---|
| 1486 | + | killed; 64 |
|---|
| 1487 | + | (10) "Prior offender", a person who has been found 65 |
|---|
| 1488 | + | guilty of a violation of this sectio n where such prior 66 |
|---|
| 1489 | + | 45 |
|---|
| 1490 | + | offense occurred within five years of the violation for 67 |
|---|
| 1491 | + | which the person is charged; 68 |
|---|
| 1492 | + | (11) "Race", the operation of one or more motor 69 |
|---|
| 1493 | + | vehicles arising from a challenge to demonstrate superiority 70 |
|---|
| 1494 | + | of a motor vehicle or driver, and the acceptance of or 71 |
|---|
| 1495 | + | competitive response to that challenge, either through a 72 |
|---|
| 1496 | + | prior arrangement or in immediate response, in which the 73 |
|---|
| 1497 | + | competitor attempts to outgain or outdistance another motor 74 |
|---|
| 1498 | + | vehicle, to prevent another motor vehicle from passing, to 75 |
|---|
| 1499 | + | arrive at a given destination ahead of another motor 76 |
|---|
| 1500 | + | vehicle, to test the physical stamina or endurance of 77 |
|---|
| 1501 | + | drivers, to exhibit speed or acceleration, or to set a speed 78 |
|---|
| 1502 | + | or acceleration record; 79 |
|---|
| 1503 | + | (12) "Street takeover", the act of disrupting the 80 |
|---|
| 1504 | + | regular flow of traffic for the purpose of performing, 81 |
|---|
| 1505 | + | facilitating, or spectating stunt driving; 82 |
|---|
| 1506 | + | (13) "Stunt driving", to operate a motor vehicle 83 |
|---|
| 1507 | + | performing a race, a drag race, a burnout, a donut, a 84 |
|---|
| 1508 | + | wheelie, or drifting; 85 |
|---|
| 1509 | + | (14) "Wheelie", a motor vehicle maneuver whereby a 86 |
|---|
| 1510 | + | vehicle is ridden for a distance with the front or rear 87 |
|---|
| 1511 | + | wheel or wheels raised off the ground. 88 |
|---|
| 1512 | + | 2. Except as otherwise permitted by law, no person 89 |
|---|
| 1513 | + | shall: 90 |
|---|
| 1514 | + | (1) Perform stunt driving in connection with a street 91 |
|---|
| 1515 | + | takeover; or 92 |
|---|
| 1516 | + | (2) Perform or participate in a street takeover. 93 |
|---|
| 1517 | + | 3. Violation of this section shall be a class B 94 |
|---|
| 1518 | + | misdemeanor for a first offense, a class A misdemeanor for a 95 |
|---|
| 1519 | + | second offense, and a class E felony for a third or 96 |
|---|
| 1520 | + | subsequent offense. 97 |
|---|
| 1521 | + | 4. No defendant alleged and proven to be a prior 98 |
|---|
| 1522 | + | offender, persistent offender, aggravated offender, chronic 99 |
|---|
| 1523 | + | 46 |
|---|
| 1524 | + | offender, or habitual offender shall be granted a suspended 100 |
|---|
| 1525 | + | imposition of sentence or be sentenced to pay a fine in lieu 101 |
|---|
| 1526 | + | of imprisonment. 102 |
|---|
| 1527 | + | 5. No defendant alleged and proven to be a prior 103 |
|---|
| 1528 | + | offender shall be granted probation or parole until he or 104 |
|---|
| 1529 | + | she has served a minimum of ten days of imprisonment, unless 105 |
|---|
| 1530 | + | as a condition of such probation or parole the person 106 |
|---|
| 1531 | + | performs at least thi rty days of community service under the 107 |
|---|
| 1532 | + | supervision of the court in a jurisdiction that has a 108 |
|---|
| 1533 | + | recognized program for community service. 109 |
|---|
| 1534 | + | 6. No defendant alleged and proven to be an aggravated 110 |
|---|
| 1535 | + | offender shall be eligible for probation or parole until he 111 |
|---|
| 1536 | + | or she has served a minimum of thirty days of imprisonment. 112 |
|---|
| 1537 | + | 7. No defendant alleged and proven to be a chronic or 113 |
|---|
| 1538 | + | habitual offender shall be eligible for probation or parole 114 |
|---|
| 1539 | + | until he or she has served a minimum of one year of 115 |
|---|
| 1540 | + | imprisonment. 116 |
|---|
| 1541 | + | 8. Prior pleas of guilty and prior findings of guilty 117 |
|---|
| 1542 | + | shall be pleaded and proven in the same manner as required 118 |
|---|
| 1543 | + | by section 558.021. 119 |
|---|
| 1544 | + | 9. This section shall not apply to events sanctioned 120 |
|---|
| 1545 | + | by a political subdivision or private entity with 121 |
|---|
| 1546 | + | responsibility for maintenance and control of the portion of 122 |
|---|
| 1547 | + | highway or private property on which the motor vehicle 123 |
|---|
| 1548 | + | operation occurs. 124 |
|---|
| 1549 | + | 455.095. 1. For purposes of this section, the 1 |
|---|
| 1550 | + | following terms mean: 2 |
|---|
| 1551 | + | (1) "Electronic monitoring w ith victim notification", 3 |
|---|
| 1552 | + | an electronic monitoring system that has the capability to 4 |
|---|
| 1553 | + | track and monitor the movement of a person and immediately 5 |
|---|
| 1554 | + | transmit the monitored person's location to the protected 6 |
|---|
| 1555 | + | person and the local law enforcement agency with 7 |
|---|
| 1556 | + | jurisdiction over the protected premises through an 8 |
|---|
| 1557 | + | 47 |
|---|
| 1558 | + | appropriate means, including the telephone, an electronic 9 |
|---|
| 1559 | + | beeper, or paging device whenever the monitored person 10 |
|---|
| 1560 | + | enters the protected premises as specified in the order by 11 |
|---|
| 1561 | + | the court; 12 |
|---|
| 1562 | + | (2) "Informed consent", the protected person is given 13 |
|---|
| 1563 | + | the following information before consenting to participate 14 |
|---|
| 1564 | + | in electronic monitoring with victim notification: 15 |
|---|
| 1565 | + | (a) The protected person's right to refuse to 16 |
|---|
| 1566 | + | participate in such monitoring and the process f or 17 |
|---|
| 1567 | + | requesting the court to terminate his or her participation 18 |
|---|
| 1568 | + | after it has been ordered; 19 |
|---|
| 1569 | + | (b) The manner in which the electronic monitoring 20 |
|---|
| 1570 | + | technology functions and the risks and limitations of that 21 |
|---|
| 1571 | + | technology; 22 |
|---|
| 1572 | + | (c) The boundaries imposed on the person being 23 |
|---|
| 1573 | + | monitored during the electronic monitoring; 24 |
|---|
| 1574 | + | (d) The sanctions that the court may impose for 25 |
|---|
| 1575 | + | violations of the order issued by the court; 26 |
|---|
| 1576 | + | (e) The procedure that the protected person is to 27 |
|---|
| 1577 | + | follow if the monitored person violat es an order or if the 28 |
|---|
| 1578 | + | electronic monitoring equipment fails; 29 |
|---|
| 1579 | + | (f) Identification of support services available to 30 |
|---|
| 1580 | + | assist the protected person in developing a safety plan to 31 |
|---|
| 1581 | + | use if the monitored person violates an order or if the 32 |
|---|
| 1582 | + | electronic monitoring equipment fails; 33 |
|---|
| 1583 | + | (g) Identification of community services available to 34 |
|---|
| 1584 | + | assist the protected person in obtaining shelter, 35 |
|---|
| 1585 | + | counseling, education, child care, legal representation, and 36 |
|---|
| 1586 | + | other help in addressing the consequences and effects of 37 |
|---|
| 1587 | + | domestic violence; and 38 |
|---|
| 1588 | + | (h) The nonconfidential nature of the protected 39 |
|---|
| 1589 | + | person's communications with the court concerning electronic 40 |
|---|
| 1590 | + | 48 |
|---|
| 1591 | + | monitoring and the restrictions to be imposed upon the 41 |
|---|
| 1592 | + | monitored person's movements. 42 |
|---|
| 1593 | + | 2. When a person is found g uilty of violating the 43 |
|---|
| 1594 | + | terms and conditions of an ex parte or full order of 44 |
|---|
| 1595 | + | protection under section 455.085 or 455.538, the court may, 45 |
|---|
| 1596 | + | in addition to or in lieu of any other disposition: 46 |
|---|
| 1597 | + | (1) Sentence the person to electronic monitoring with 47 |
|---|
| 1598 | + | victim notification; or 48 |
|---|
| 1599 | + | (2) Place the person on probation and, as a condition 49 |
|---|
| 1600 | + | of such probation, order electronic monitoring with victim 50 |
|---|
| 1601 | + | notification. 51 |
|---|
| 1602 | + | 3. When a person charged with violating the terms and 52 |
|---|
| 1603 | + | conditions of an ex parte or full order of protection under 53 |
|---|
| 1604 | + | section 455.085 or 455.538 is released from custody before 54 |
|---|
| 1605 | + | trial pursuant to section 544.455, the court may, as a 55 |
|---|
| 1606 | + | condition of release, order electronic monitoring of the 56 |
|---|
| 1607 | + | person with victim notification. 57 |
|---|
| 1608 | + | 4. Electronic monitoring with victim notification 58 |
|---|
| 1609 | + | shall be ordered only with the protected person's informed 59 |
|---|
| 1610 | + | consent. In determining whether to place a person on 60 |
|---|
| 1611 | + | electronic monitoring with victim notification, the court 61 |
|---|
| 1612 | + | may hold a hearing to consider the likelihood that th e 62 |
|---|
| 1613 | + | person's participation in electronic monitoring will deter 63 |
|---|
| 1614 | + | the person from injuring the protected person. The court 64 |
|---|
| 1615 | + | shall consider the following factors: 65 |
|---|
| 1616 | + | (1) The gravity and seriousness of harm that the 66 |
|---|
| 1617 | + | person inflicted on the protected person in the commission 67 |
|---|
| 1618 | + | of any act of domestic violence; 68 |
|---|
| 1619 | + | (2) The person's previous history of domestic violence; 69 |
|---|
| 1620 | + | (3) The person's history of other criminal acts, if 70 |
|---|
| 1621 | + | any; 71 |
|---|
| 1622 | + | (4) Whether the person has access to a weapon; 72 |
|---|
| 1623 | + | 49 |
|---|
| 1624 | + | (5) Whether the person has threatened suicide or 73 |
|---|
| 1625 | + | homicide; 74 |
|---|
| 1626 | + | (6) Whether the person has a history of mental illness 75 |
|---|
| 1627 | + | or has been civilly committed; and 76 |
|---|
| 1628 | + | (7) Whether the person has a history of alcohol or 77 |
|---|
| 1629 | + | substance abuse. 78 |
|---|
| 1630 | + | 5. Unless the person is determined t o be indigent by 79 |
|---|
| 1631 | + | the court, a person ordered to be placed on electronic 80 |
|---|
| 1632 | + | monitoring with victim notification shall be ordered to pay 81 |
|---|
| 1633 | + | the related costs and expenses. If the court determines the 82 |
|---|
| 1634 | + | person is indigent, the person may be placed on electronic 83 |
|---|
| 1635 | + | monitoring with victim notification, and the clerk of the 84 |
|---|
| 1636 | + | court in which the case was determined shall notify the 85 |
|---|
| 1637 | + | department of corrections that the person was determined to 86 |
|---|
| 1638 | + | be indigent and shall include in a bill to the department 87 |
|---|
| 1639 | + | the costs associated with the monitoring. The department 88 |
|---|
| 1640 | + | shall establish by rule a procedure to determine the portion 89 |
|---|
| 1641 | + | of costs each indigent person is able to pay based on a 90 |
|---|
| 1642 | + | person's income, number of dependents, and other factors as 91 |
|---|
| 1643 | + | determined by the department and sha ll seek reimbursement of 92 |
|---|
| 1644 | + | such costs. 93 |
|---|
| 1645 | + | 6. An alert from an electronic monitoring device shall 94 |
|---|
| 1646 | + | be probable cause to arrest the monitored person for a 95 |
|---|
| 1647 | + | violation of an ex parte or full order of protection. 96 |
|---|
| 1648 | + | 7. The department of corrections, depart ment of public 97 |
|---|
| 1649 | + | safety, Missouri state highway patrol, the circuit courts, 98 |
|---|
| 1650 | + | and county and municipal law enforcement agencies shall 99 |
|---|
| 1651 | + | share information obtained via electronic monitoring 100 |
|---|
| 1652 | + | conducted pursuant to this section. 101 |
|---|
| 1653 | + | 8. No supplier of a product , system, or service used 102 |
|---|
| 1654 | + | for electronic monitoring with victim notification shall be 103 |
|---|
| 1655 | + | liable, directly or indirectly, for damages arising from any 104 |
|---|
| 1656 | + | injury or death associated with the use of the product, 105 |
|---|
| 1657 | + | 50 |
|---|
| 1658 | + | system, or service unless, and only to the extent that, such 106 |
|---|
| 1659 | + | action is based on a claim that the injury or death was 107 |
|---|
| 1660 | + | proximately caused by a manufacturing defect in the product 108 |
|---|
| 1661 | + | or system. 109 |
|---|
| 1662 | + | 9. Nothing in this section shall be construed as 110 |
|---|
| 1663 | + | limiting a court's ability to place a person on electronic 111 |
|---|
| 1664 | + | monitoring without victim notification under section 544.455 112 |
|---|
| 1665 | + | or 557.011. 113 |
|---|
| 1666 | + | 10. A person shall be found guilty of the offense of 114 |
|---|
| 1667 | + | tampering with electronic monitoring equipment under section 115 |
|---|
| 1668 | + | 575.205 if he or she commits the actions prohibited under 116 |
|---|
| 1669 | + | such section with any equipment that a court orders the 117 |
|---|
| 1670 | + | person to wear under this section. 118 |
|---|
| 1671 | + | 11. The department of corrections shall promulgate 119 |
|---|
| 1672 | + | rules and regulations for the implementation of subsection 5 120 |
|---|
| 1673 | + | of this section. Any rule or portion of a rule, as that 121 |
|---|
| 1674 | + | term is defined in section 536.010, that is created under 122 |
|---|
| 1675 | + | the authority delegated in this section shall become 123 |
|---|
| 1676 | + | effective only if it complies with and is subject to all of 124 |
|---|
| 1677 | + | the provisions of chapter 536 and, if applicable, section 125 |
|---|
| 1678 | + | 536.028. This section and chapter 536 are nonseverable and 126 |
|---|
| 1679 | + | if any of the powers vested with the general assembly 127 |
|---|
| 1680 | + | pursuant to chapter 536 to review, to delay the effective 128 |
|---|
| 1681 | + | date, or to disapprove and annul a rule are subsequently 129 |
|---|
| 1682 | + | held unconstitutional, then the grant of rulemaking 130 |
|---|
| 1683 | + | authority and any rule proposed or adopted after August 28, 131 |
|---|
| 1684 | + | 2018, shall be invalid and void. 132 |
|---|
| 1685 | + | [12. The provisions of this section shall expire on 133 |
|---|
| 1686 | + | August 28, 2024.] 134 |
|---|
| 1687 | + | 491.065. 1. As used in this section, unl ess the 1 |
|---|
| 1688 | + | context otherwise requires, the following terms mean: 2 |
|---|
| 1689 | + | (1) "Benefit", any plea bargain, bail consideration, 3 |
|---|
| 1690 | + | reduction or modification of sentence, or any other 4 |
|---|
| 1691 | + | 51 |
|---|
| 1692 | + | leniency, immunity, financial payment, reward, or 5 |
|---|
| 1693 | + | amelioration of current or fu ture conditions of 6 |
|---|
| 1694 | + | incarceration that has been requested or that has been or 7 |
|---|
| 1695 | + | may, at a future date, be offered or provided in connection 8 |
|---|
| 1696 | + | with or in exchange for the testimony of an informant who 9 |
|---|
| 1697 | + | was endorsed by the state; 10 |
|---|
| 1698 | + | (2) "Informant", a witne ss who provides testimony that 11 |
|---|
| 1699 | + | offers allegedly self -incriminating statements or activities 12 |
|---|
| 1700 | + | of another person who is under investigation or being 13 |
|---|
| 1701 | + | charged with an offense, and the witness: 14 |
|---|
| 1702 | + | (a) Is or was incarcerated with the suspect or 15 |
|---|
| 1703 | + | defendant; 16 |
|---|
| 1704 | + | (b) Is being detained by or in the custody of law 17 |
|---|
| 1705 | + | enforcement; or 18 |
|---|
| 1706 | + | (c) Provides testimony in exchange for any benefit. 19 |
|---|
| 1707 | + | The term "informant" shall not refer to or include a 20 |
|---|
| 1708 | + | codefendant or victim involved in the case. 21 |
|---|
| 1709 | + | 2. Beginning January 1, 2026, and thereafter, each 22 |
|---|
| 1710 | + | prosecuting or circuit attorney shall send the information 23 |
|---|
| 1711 | + | described under subdivision (4) of subsection 2 of section 24 |
|---|
| 1712 | + | 56.750 to the Missouri office of prosecution services to be 25 |
|---|
| 1713 | + | included in the summary report as defined in subsection 2 of 26 |
|---|
| 1714 | + | section 56.750. 27 |
|---|
| 1715 | + | 3. If a prosecuting or circuit attorney endorses a 28 |
|---|
| 1716 | + | witness to testify as an informant, the following material 29 |
|---|
| 1717 | + | and information shall be disclosed to all attorneys of 30 |
|---|
| 1718 | + | record within fourteen days of the endorsement b y the 31 |
|---|
| 1719 | + | prosecuting or circuit attorney: 32 |
|---|
| 1720 | + | (1) The complete criminal history of the informant, 33 |
|---|
| 1721 | + | including any charges that are pending or were reduced, 34 |
|---|
| 1722 | + | amended, or dismissed as part of a plea bargain; 35 |
|---|
| 1723 | + | (2) The informant cooperation agreement and a copy of 36 |
|---|
| 1724 | + | any deal, promise, inducement, or benefit that has been 37 |
|---|
| 1725 | + | 52 |
|---|
| 1726 | + | requested or that has been or may, at a future date, be 38 |
|---|
| 1727 | + | offered or provided to the informant in connection with 39 |
|---|
| 1728 | + | testimony against the defendant's interest; 40 |
|---|
| 1729 | + | (3) The substance, time, and place of any statement 41 |
|---|
| 1730 | + | allegedly given by the defendant to the informant, and the 42 |
|---|
| 1731 | + | substance, time, and place of any statement given by the 43 |
|---|
| 1732 | + | informant to a law enforcement agency implicating the 44 |
|---|
| 1733 | + | defendant in the offense charged; 45 |
|---|
| 1734 | + | (4) Whether the informant recanted that testimony or 46 |
|---|
| 1735 | + | statement and, if so, the time and place of the recantation, 47 |
|---|
| 1736 | + | the nature of the recantation, and the names of the persons 48 |
|---|
| 1737 | + | who were present at the recantation; and 49 |
|---|
| 1738 | + | (5) Information concerning other criminal cases in any 50 |
|---|
| 1739 | + | county in which the informant was endorsed by the state to 51 |
|---|
| 1740 | + | testify against a defendant, including the following: 52 |
|---|
| 1741 | + | (a) The case name and number; 53 |
|---|
| 1742 | + | (b) The substance of the testimony; 54 |
|---|
| 1743 | + | (c) Any cooperation agreement, deal, promise, 55 |
|---|
| 1744 | + | inducement, or benefit that was requested, offered, or 56 |
|---|
| 1745 | + | provided to the informant in connection with the informant's 57 |
|---|
| 1746 | + | testimony; and 58 |
|---|
| 1747 | + | (d) Any other information that is requested to be 59 |
|---|
| 1748 | + | disclosed under the Constitution of the United States, the 60 |
|---|
| 1749 | + | Constitution of Missouri, and the Missouri supreme court 61 |
|---|
| 1750 | + | rules of criminal procedure. 62 |
|---|
| 1751 | + | 513.605. As used in sections 513.600 to 513.645, 1 |
|---|
| 1752 | + | unless the context clearly indicates otherwise, the 2 |
|---|
| 1753 | + | following terms mean: 3 |
|---|
| 1754 | + | (1) (a) "Beneficial interest": 4 |
|---|
| 1755 | + | a. The interest of a person as a beneficiary under any 5 |
|---|
| 1756 | + | other trust arrangement pursuant to which a trustee holds 6 |
|---|
| 1757 | + | legal or record title to real property for the benefit of 7 |
|---|
| 1758 | + | such person; or 8 |
|---|
| 1759 | + | 53 |
|---|
| 1760 | + | b. The interest of a person under any other fo rm of 9 |
|---|
| 1761 | + | express fiduciary arrangement pursuant to which any other 10 |
|---|
| 1762 | + | person holds legal or record title to real property for the 11 |
|---|
| 1763 | + | benefit of such person; 12 |
|---|
| 1764 | + | (b) "Beneficial interest" does not include the 13 |
|---|
| 1765 | + | interest of a stockholder in a corporation or the i nterest 14 |
|---|
| 1766 | + | of a partner in either a general partnership or limited 15 |
|---|
| 1767 | + | partnership. A beneficial interest shall be deemed to be 16 |
|---|
| 1768 | + | located where the real property owned by the trustee is 17 |
|---|
| 1769 | + | located; 18 |
|---|
| 1770 | + | (2) "Civil proceeding", any civil suit commenced by an 19 |
|---|
| 1771 | + | investigative agency under any provision of sections 513.600 20 |
|---|
| 1772 | + | to 513.645; 21 |
|---|
| 1773 | + | (3) "Criminal activity" is the commission, attempted 22 |
|---|
| 1774 | + | commission, conspiracy to commit, or the solicitation, 23 |
|---|
| 1775 | + | coercion or intimidation of another person to commit any 24 |
|---|
| 1776 | + | crime which is chargeable by indictment or information under 25 |
|---|
| 1777 | + | the following Missouri laws: 26 |
|---|
| 1778 | + | (a) Chapter 195, relating to drug regulations; 27 |
|---|
| 1779 | + | (b) Chapter 301, relating to registration and 28 |
|---|
| 1780 | + | licensing of motor vehicles; 29 |
|---|
| 1781 | + | (c) Chapter 304, but relating only to felony 30 |
|---|
| 1782 | + | violations of this chapter involving the use of a motor 31 |
|---|
| 1783 | + | vehicle; 32 |
|---|
| 1784 | + | (d) Chapter 311, but relating only to felony 33 |
|---|
| 1785 | + | violations of this chapter committed by persons not duly 34 |
|---|
| 1786 | + | licensed by the supervisor of liquor control; 35 |
|---|
| 1787 | + | (e) Chapter 409, relating to regulation of securities; 36 |
|---|
| 1788 | + | (f) Chapter 491, relating to witnesses; 37 |
|---|
| 1789 | + | (g) Chapter 565, relating to offenses against the 38 |
|---|
| 1790 | + | person; 39 |
|---|
| 1791 | + | [(c)] (h) Chapter 566, relating to sexual offenses; 40 |
|---|
| 1792 | + | [(d)] (i) Chapter 567, relating to prostitu tion; 41 |
|---|
| 1793 | + | 54 |
|---|
| 1794 | + | (j) Chapter 568, relating to offenses against the 42 |
|---|
| 1795 | + | family; 43 |
|---|
| 1796 | + | [(e)] (k) Chapter 569, relating to robbery, arson, 44 |
|---|
| 1797 | + | burglary and related offenses; 45 |
|---|
| 1798 | + | [(f)] (l) Chapter 570, relating to stealing and 46 |
|---|
| 1799 | + | related offenses; 47 |
|---|
| 1800 | + | [(g) Chapter 567, relating to prostitution; 48 |
|---|
| 1801 | + | (h)] (m) Chapter 571, relating to weapons offenses; 49 |
|---|
| 1802 | + | (n) Chapter 572, relating to gambling; 50 |
|---|
| 1803 | + | (o) Chapter 573, relating to pornography and related 51 |
|---|
| 1804 | + | offenses; 52 |
|---|
| 1805 | + | [(i)] (p) Chapter 574, relating to offenses agains t 53 |
|---|
| 1806 | + | public order; 54 |
|---|
| 1807 | + | [(j)] (q) Chapter 575, relating to offenses against 55 |
|---|
| 1808 | + | the administration of justice; 56 |
|---|
| 1809 | + | [(k) Chapter 491, relating to witnesses; 57 |
|---|
| 1810 | + | (l) Chapter 572, relating to gambling; 58 |
|---|
| 1811 | + | (m) Chapter 311, but relating only to felony 59 |
|---|
| 1812 | + | violations of this chapter committed by persons not duly 60 |
|---|
| 1813 | + | licensed by the supervisor of liquor control; 61 |
|---|
| 1814 | + | (n) Chapter 571, relating to weapons offenses; 62 |
|---|
| 1815 | + | (o) Chapter 409, relating to regulation of securities; 63 |
|---|
| 1816 | + | (p) Chapter 301, relating to registra tion and 64 |
|---|
| 1817 | + | licensing of motor vehicles ] 65 |
|---|
| 1818 | + | (r) Chapter 578, but only relating to offenses by a 66 |
|---|
| 1819 | + | criminal street gang ; 67 |
|---|
| 1820 | + | (4) "Criminal proceeding", any criminal prosecution 68 |
|---|
| 1821 | + | commenced by an investigative agency under any criminal law 69 |
|---|
| 1822 | + | of this state; 70 |
|---|
| 1823 | + | (5) "Investigative agency", the attorney general's 71 |
|---|
| 1824 | + | office, or the office of any prosecuting attorney or circuit 72 |
|---|
| 1825 | + | attorney; 73 |
|---|
| 1826 | + | (6) "Pecuniary value": 74 |
|---|
| 1827 | + | 55 |
|---|
| 1828 | + | (a) Anything of value in the form of money, a 75 |
|---|
| 1829 | + | negotiable instrument, a commercial interest, or anything 76 |
|---|
| 1830 | + | else the primary significance of which is economic 77 |
|---|
| 1831 | + | advantage; or 78 |
|---|
| 1832 | + | (b) Any other property or service that has a value in 79 |
|---|
| 1833 | + | excess of one hundred dollars; 80 |
|---|
| 1834 | + | (7) "Real property", any estate or legal or equitable 81 |
|---|
| 1835 | + | interest in land situat ed in this state or any interest in 82 |
|---|
| 1836 | + | such real property, including, but not limited to, any lease 83 |
|---|
| 1837 | + | or deed of trust upon such real property; 84 |
|---|
| 1838 | + | (8) "Seizing agency", the agency which is the primary 85 |
|---|
| 1839 | + | employer of the officer or agent seizing the property, 86 |
|---|
| 1840 | + | including any agency in which one or more of the employees 87 |
|---|
| 1841 | + | acting on behalf of the seizing agency is employed by the 88 |
|---|
| 1842 | + | state of Missouri or any political subdivision of this state; 89 |
|---|
| 1843 | + | (9) "Seizure", the point at which any law enforcement 90 |
|---|
| 1844 | + | officer or agent discovers and exercises any control over 91 |
|---|
| 1845 | + | property that an officer or agent has reason to believe was 92 |
|---|
| 1846 | + | used or intended for use in the course of, derived from, or 93 |
|---|
| 1847 | + | realized through criminal activity. Seizure includes but is 94 |
|---|
| 1848 | + | not limited to preventing anyone found in possession of the 95 |
|---|
| 1849 | + | property from leaving the scene of the investigation while 96 |
|---|
| 1850 | + | in possession of the property; 97 |
|---|
| 1851 | + | (10) (a) "Trustee": 98 |
|---|
| 1852 | + | a. Any person who holds legal or record title to real 99 |
|---|
| 1853 | + | property for which any other person has a beneficial 100 |
|---|
| 1854 | + | interest; or 101 |
|---|
| 1855 | + | b. Any successor trustee or trustees to any of the 102 |
|---|
| 1856 | + | foregoing persons; 103 |
|---|
| 1857 | + | (b) "Trustee" does not include the following: 104 |
|---|
| 1858 | + | a. Any person appointed or acting as a personal 105 |
|---|
| 1859 | + | representative under chapter 475 or under chap ter 473; 106 |
|---|
| 1860 | + | 56 |
|---|
| 1861 | + | b. Any person appointed or acting as a trustee of any 107 |
|---|
| 1862 | + | testamentary trust or as trustee of any indenture of trust 108 |
|---|
| 1863 | + | under which any bonds are or are to be issued. 109 |
|---|
| 1864 | + | 556.061. In this code, unless the context requires a 1 |
|---|
| 1865 | + | different definition, the following terms shall mean: 2 |
|---|
| 1866 | + | (1) "Access", to instruct, communicate with, store 3 |
|---|
| 1867 | + | data in, retrieve or extract data from, or otherwise make 4 |
|---|
| 1868 | + | any use of any resources of, a computer, computer system, or 5 |
|---|
| 1869 | + | computer network; 6 |
|---|
| 1870 | + | (2) "Affirmative defense": 7 |
|---|
| 1871 | + | (a) The defense referred to is not submitted to the 8 |
|---|
| 1872 | + | trier of fact unless supported by evidence; and 9 |
|---|
| 1873 | + | (b) If the defense is submitted to the trier of fact 10 |
|---|
| 1874 | + | the defendant has the burden of persuasion that the defense 11 |
|---|
| 1875 | + | is more probably true than not; 12 |
|---|
| 1876 | + | (3) "Burden of injecting the issue": 13 |
|---|
| 1877 | + | (a) The issue referred to is not submitted to the 14 |
|---|
| 1878 | + | trier of fact unless supported by evidence; and 15 |
|---|
| 1879 | + | (b) If the issue is submitted to the trier of fact any 16 |
|---|
| 1880 | + | reasonable doubt on the issue requires a finding for the 17 |
|---|
| 1881 | + | defendant on that issue; 18 |
|---|
| 1882 | + | (4) "Commercial film and photographic print 19 |
|---|
| 1883 | + | processor", any person who develops exposed photographic 20 |
|---|
| 1884 | + | film into negatives, slides or prints, or who makes prints 21 |
|---|
| 1885 | + | from negatives or sli des, for compensation. The term 22 |
|---|
| 1886 | + | commercial film and photographic print processor shall 23 |
|---|
| 1887 | + | include all employees of such persons but shall not include 24 |
|---|
| 1888 | + | a person who develops film or makes prints for a public 25 |
|---|
| 1889 | + | agency; 26 |
|---|
| 1890 | + | (5) "Computer", the box that house s the central 27 |
|---|
| 1891 | + | processing unit (CPU), along with any internal storage 28 |
|---|
| 1892 | + | devices, such as internal hard drives, and internal 29 |
|---|
| 1893 | + | communication devices, such as internal modems capable of 30 |
|---|
| 1894 | + | 57 |
|---|
| 1895 | + | sending or receiving electronic mail or fax cards, along 31 |
|---|
| 1896 | + | with any other hardware stored or housed internally. Thus, 32 |
|---|
| 1897 | + | computer refers to hardware, software and data contained in 33 |
|---|
| 1898 | + | the main unit. Printers, external modems attached by cable 34 |
|---|
| 1899 | + | to the main unit, monitors, and other external attachments 35 |
|---|
| 1900 | + | will be referred to collecti vely as peripherals and 36 |
|---|
| 1901 | + | discussed individually when appropriate. When the computer 37 |
|---|
| 1902 | + | and all peripherals are referred to as a package, the term 38 |
|---|
| 1903 | + | "computer system" is used. Information refers to all the 39 |
|---|
| 1904 | + | information on a computer system including both sof tware 40 |
|---|
| 1905 | + | applications and data; 41 |
|---|
| 1906 | + | (6) "Computer equipment", computers, terminals, data 42 |
|---|
| 1907 | + | storage devices, and all other computer hardware associated 43 |
|---|
| 1908 | + | with a computer system or network; 44 |
|---|
| 1909 | + | (7) "Computer hardware", all equipment which can 45 |
|---|
| 1910 | + | collect, analyze, create, display, convert, store, conceal 46 |
|---|
| 1911 | + | or transmit electronic, magnetic, optical or similar 47 |
|---|
| 1912 | + | computer impulses or data. Hardware includes, but is not 48 |
|---|
| 1913 | + | limited to, any data processing devices, such as central 49 |
|---|
| 1914 | + | processing units, memory typewriters an d self-contained 50 |
|---|
| 1915 | + | laptop or notebook computers; internal and peripheral 51 |
|---|
| 1916 | + | storage devices, transistor -like binary devices and other 52 |
|---|
| 1917 | + | memory storage devices, such as floppy disks, removable 53 |
|---|
| 1918 | + | disks, compact disks, digital video disks, magnetic tape, 54 |
|---|
| 1919 | + | hard drive, optical disks and digital memory; local area 55 |
|---|
| 1920 | + | networks, such as two or more computers connected together 56 |
|---|
| 1921 | + | to a central computer server via cable or modem; peripheral 57 |
|---|
| 1922 | + | input or output devices, such as keyboards, printers, 58 |
|---|
| 1923 | + | scanners, plotters, video disp lay monitors and optical 59 |
|---|
| 1924 | + | readers; and related communication devices, such as modems, 60 |
|---|
| 1925 | + | cables and connections, recording equipment, RAM or ROM 61 |
|---|
| 1926 | + | units, acoustic couplers, automatic dialers, speed dialers, 62 |
|---|
| 1927 | + | programmable telephone dialing or signaling devices and 63 |
|---|
| 1928 | + | 58 |
|---|
| 1929 | + | electronic tone-generating devices; as well as any devices, 64 |
|---|
| 1930 | + | mechanisms or parts that can be used to restrict access to 65 |
|---|
| 1931 | + | computer hardware, such as physical keys and locks; 66 |
|---|
| 1932 | + | (8) "Computer network", two or more interconnected 67 |
|---|
| 1933 | + | computers or computer systems; 68 |
|---|
| 1934 | + | (9) "Computer program", a set of instructions, 69 |
|---|
| 1935 | + | statements, or related data that directs or is intended to 70 |
|---|
| 1936 | + | direct a computer to perform certain functions; 71 |
|---|
| 1937 | + | (10) "Computer software", digital information which 72 |
|---|
| 1938 | + | can be interpreted by a computer and any of its related 73 |
|---|
| 1939 | + | components to direct the way they work. Software is stored 74 |
|---|
| 1940 | + | in electronic, magnetic, optical or other digital form. The 75 |
|---|
| 1941 | + | term commonly includes programs to run operating systems and 76 |
|---|
| 1942 | + | applications, such as word processing , graphic, or 77 |
|---|
| 1943 | + | spreadsheet programs, utilities, compilers, interpreters and 78 |
|---|
| 1944 | + | communications programs; 79 |
|---|
| 1945 | + | (11) "Computer-related documentation", written, 80 |
|---|
| 1946 | + | recorded, printed or electronically stored material which 81 |
|---|
| 1947 | + | explains or illustrates how to configure or use computer 82 |
|---|
| 1948 | + | hardware, software or other related items; 83 |
|---|
| 1949 | + | (12) "Computer system", a set of related, connected or 84 |
|---|
| 1950 | + | unconnected, computer equipment, data, or software; 85 |
|---|
| 1951 | + | (13) "Confinement": 86 |
|---|
| 1952 | + | (a) A person is in confinement when such person i s 87 |
|---|
| 1953 | + | held in a place of confinement pursuant to arrest or order 88 |
|---|
| 1954 | + | of a court, and remains in confinement until: 89 |
|---|
| 1955 | + | a. A court orders the person's release; or 90 |
|---|
| 1956 | + | b. The person is released on bail, bond, or 91 |
|---|
| 1957 | + | recognizance, personal or otherwise; or 92 |
|---|
| 1958 | + | c. A public servant having the legal power and duty to 93 |
|---|
| 1959 | + | confine the person authorizes his release without guard and 94 |
|---|
| 1960 | + | without condition that he return to confinement; 95 |
|---|
| 1961 | + | (b) A person is not in confinement if: 96 |
|---|
| 1962 | + | 59 |
|---|
| 1963 | + | a. The person is on probation or parole, temporary or 97 |
|---|
| 1964 | + | otherwise; or 98 |
|---|
| 1965 | + | b. The person is under sentence to serve a term of 99 |
|---|
| 1966 | + | confinement which is not continuous, or is serving a 100 |
|---|
| 1967 | + | sentence under a work -release program, and in either such 101 |
|---|
| 1968 | + | case is not being held in a place of confinement or is n ot 102 |
|---|
| 1969 | + | being held under guard by a person having the legal power 103 |
|---|
| 1970 | + | and duty to transport the person to or from a place of 104 |
|---|
| 1971 | + | confinement; 105 |
|---|
| 1972 | + | (14) "Consent": consent or lack of consent may be 106 |
|---|
| 1973 | + | expressed or implied. Assent does not constitute consent if: 107 |
|---|
| 1974 | + | (a) It is given by a person who lacks the mental 108 |
|---|
| 1975 | + | capacity to authorize the conduct charged to constitute the 109 |
|---|
| 1976 | + | offense and such mental incapacity is manifest or known to 110 |
|---|
| 1977 | + | the actor; or 111 |
|---|
| 1978 | + | (b) It is given by a person who by reason of youth, 112 |
|---|
| 1979 | + | mental disease or defect, intoxication, a drug -induced 113 |
|---|
| 1980 | + | state, or any other reason is manifestly unable or known by 114 |
|---|
| 1981 | + | the actor to be unable to make a reasonable judgment as to 115 |
|---|
| 1982 | + | the nature or harmfulness of the conduct charged to 116 |
|---|
| 1983 | + | constitute the offense; or 117 |
|---|
| 1984 | + | (c) It is induced by force, duress or deception; 118 |
|---|
| 1985 | + | (15) "Controlled substance", a drug, substance, or 119 |
|---|
| 1986 | + | immediate precursor in schedules I through V as defined in 120 |
|---|
| 1987 | + | chapter 195; 121 |
|---|
| 1988 | + | (16) "Criminal negligence", failure to be aware of a 122 |
|---|
| 1989 | + | substantial and unjustifiable risk that circumstances exist 123 |
|---|
| 1990 | + | or a result will follow, and such failure constitutes a 124 |
|---|
| 1991 | + | gross deviation from the standard of care which a reasonable 125 |
|---|
| 1992 | + | person would exercise in the situation; 126 |
|---|
| 1993 | + | (17) "Custody", a person is in custody when he or she 127 |
|---|
| 1994 | + | has been arrested but has not been delivered to a place of 128 |
|---|
| 1995 | + | confinement; 129 |
|---|
| 1996 | + | 60 |
|---|
| 1997 | + | (18) "Damage", when used in relation to a computer 130 |
|---|
| 1998 | + | system or network, means any alteration, deletion, or 131 |
|---|
| 1999 | + | destruction of any part of the computer system or network; 132 |
|---|
| 2000 | + | (19) "Dangerous felony", the felonies of arson in the 133 |
|---|
| 2001 | + | first degree, assault in the first degree, attempted rape in 134 |
|---|
| 2002 | + | the first degree if physical injury results, attempted 135 |
|---|
| 2003 | + | forcible rape if physical injury results, attempted sodomy 136 |
|---|
| 2004 | + | in the first degree if physical injury results, attempted 137 |
|---|
| 2005 | + | forcible sodomy if physical injury results, rape in the 138 |
|---|
| 2006 | + | first degree, forcible rape, sodomy in the first degree, 139 |
|---|
| 2007 | + | forcible sodomy, assault in the second degree if the victim 140 |
|---|
| 2008 | + | of such assault is a special victim as defi ned in 141 |
|---|
| 2009 | + | subdivision (14) of section 565.002, kidnapping in the first 142 |
|---|
| 2010 | + | degree, kidnapping, murder in the second degree, assault of 143 |
|---|
| 2011 | + | a law enforcement officer in the first degree, domestic 144 |
|---|
| 2012 | + | assault in the first degree, elder abuse in the first 145 |
|---|
| 2013 | + | degree, robbery in the first degree, armed criminal action, 146 |
|---|
| 2014 | + | conspiracy to commit an offense when the offense is a 147 |
|---|
| 2015 | + | dangerous felony, vehicle hijacking when punished as a class 148 |
|---|
| 2016 | + | A felony, statutory rape in the first degree when the victim 149 |
|---|
| 2017 | + | is a child less than twelve y ears of age at the time of the 150 |
|---|
| 2018 | + | commission of the act giving rise to the offense, statutory 151 |
|---|
| 2019 | + | sodomy in the first degree when the victim is a child less 152 |
|---|
| 2020 | + | than twelve years of age at the time of the commission of 153 |
|---|
| 2021 | + | the act giving rise to the offense, child mo lestation in the 154 |
|---|
| 2022 | + | first or second degree, abuse of a child if the child dies 155 |
|---|
| 2023 | + | as a result of injuries sustained from conduct chargeable 156 |
|---|
| 2024 | + | under section 568.060, child kidnapping, parental kidnapping 157 |
|---|
| 2025 | + | committed by detaining or concealing the whereabouts of t he 158 |
|---|
| 2026 | + | child for not less than one hundred twenty days under 159 |
|---|
| 2027 | + | section 565.153, bus hijacking when punished as a class A 160 |
|---|
| 2028 | + | felony, planting a bomb or explosive in or near a bus or 161 |
|---|
| 2029 | + | terminal, and an "intoxication -related traffic offense" or 162 |
|---|
| 2030 | + | 61 |
|---|
| 2031 | + | "intoxication-related boating offense" if the person is 163 |
|---|
| 2032 | + | found to be a "habitual offender" or "habitual boating 164 |
|---|
| 2033 | + | offender" as such terms are defined in section 577.001; 165 |
|---|
| 2034 | + | (20) "Dangerous instrument", any instrument, article 166 |
|---|
| 2035 | + | or substance, which, under the circumstances in which it is 167 |
|---|
| 2036 | + | used, is readily capable of causing death or other serious 168 |
|---|
| 2037 | + | physical injury; 169 |
|---|
| 2038 | + | (21) "Data", a representation of information, facts, 170 |
|---|
| 2039 | + | knowledge, concepts, or instructions prepared in a 171 |
|---|
| 2040 | + | formalized or other manner and intended for use in a 172 |
|---|
| 2041 | + | computer or computer network. Data may be in any form 173 |
|---|
| 2042 | + | including, but not limited to, printouts, microfiche, 174 |
|---|
| 2043 | + | magnetic storage media, punched cards and as may be stored 175 |
|---|
| 2044 | + | in the memory of a computer; 176 |
|---|
| 2045 | + | (22) "Deadly weapon", any firearm, loaded or unlo aded, 177 |
|---|
| 2046 | + | or any weapon from which a shot, readily capable of 178 |
|---|
| 2047 | + | producing death or serious physical injury, may be 179 |
|---|
| 2048 | + | discharged, or a switchblade knife, dagger, billy club, 180 |
|---|
| 2049 | + | blackjack or metal knuckles; 181 |
|---|
| 2050 | + | (23) "Digital camera", a camera that records images in 182 |
|---|
| 2051 | + | a format which enables the images to be downloaded into a 183 |
|---|
| 2052 | + | computer; 184 |
|---|
| 2053 | + | (24) "Disability", a mental, physical, or 185 |
|---|
| 2054 | + | developmental impairment that substantially limits one or 186 |
|---|
| 2055 | + | more major life activities or the ability to provide 187 |
|---|
| 2056 | + | adequately for one's care or protection, whether the 188 |
|---|
| 2057 | + | impairment is congenital or acquired by accident, injury or 189 |
|---|
| 2058 | + | disease, where such impairment is verified by medical 190 |
|---|
| 2059 | + | findings; 191 |
|---|
| 2060 | + | (25) "Elderly person", a person sixty years of age or 192 |
|---|
| 2061 | + | older; 193 |
|---|
| 2062 | + | 62 |
|---|
| 2063 | + | (26) "Felony", an offense so designated or an offense 194 |
|---|
| 2064 | + | for which persons found guilty thereof may be sentenced to 195 |
|---|
| 2065 | + | death or imprisonment for a term of more than one year; 196 |
|---|
| 2066 | + | (27) "Forcible compulsion" either: 197 |
|---|
| 2067 | + | (a) Physical force that overcomes reasonable 198 |
|---|
| 2068 | + | resistance; or 199 |
|---|
| 2069 | + | (b) A threat, express or implied, that places a person 200 |
|---|
| 2070 | + | in reasonable fear of death, serious physical injury or 201 |
|---|
| 2071 | + | kidnapping of such person or another person; 202 |
|---|
| 2072 | + | (28) "Incapacitated", a temporary or permanent 203 |
|---|
| 2073 | + | physical or mental condition in which a person is 204 |
|---|
| 2074 | + | unconscious, unable to appraise the nature of his or her 205 |
|---|
| 2075 | + | conduct, or unable to communicate unwillingness to an act; 206 |
|---|
| 2076 | + | (29) "Infraction", a violation defined by this code or 207 |
|---|
| 2077 | + | by any other statute of this state if it is so designated or 208 |
|---|
| 2078 | + | if no sentence other than a fine, or fine and forfeiture or 209 |
|---|
| 2079 | + | other civil penalty, is authorized upon conviction; 210 |
|---|
| 2080 | + | (30) "Inhabitable structure", a vehicle, vessel or 211 |
|---|
| 2081 | + | structure: 212 |
|---|
| 2082 | + | (a) Where any person lives or carries on business or 213 |
|---|
| 2083 | + | other calling; or 214 |
|---|
| 2084 | + | (b) Where people assemble for purposes of business, 215 |
|---|
| 2085 | + | government, education, religion, entertainment, or public 216 |
|---|
| 2086 | + | transportation; or 217 |
|---|
| 2087 | + | (c) Which is used for overnight accommodation of 218 |
|---|
| 2088 | + | persons. 219 |
|---|
| 2089 | + | Any such vehicle, vessel, or structure is inhabitabl e 220 |
|---|
| 2090 | + | regardless of whether a person is actually present. If a 221 |
|---|
| 2091 | + | building or structure is divided into separately occupied 222 |
|---|
| 2092 | + | units, any unit not occupied by the actor is an inhabitable 223 |
|---|
| 2093 | + | structure of another; 224 |
|---|
| 2094 | + | (31) "Knowingly", when used with respect to: 225 |
|---|
| 2095 | + | 63 |
|---|
| 2096 | + | (a) Conduct or attendant circumstances, means a person 226 |
|---|
| 2097 | + | is aware of the nature of his or her conduct or that those 227 |
|---|
| 2098 | + | circumstances exist; or 228 |
|---|
| 2099 | + | (b) A result of conduct, means a person is aware that 229 |
|---|
| 2100 | + | his or her conduct is practically certain to cause that 230 |
|---|
| 2101 | + | result; 231 |
|---|
| 2102 | + | (32) "Law enforcement officer", any public servant 232 |
|---|
| 2103 | + | having both the power and duty to make arrests for 233 |
|---|
| 2104 | + | violations of the laws of this state, and federal law 234 |
|---|
| 2105 | + | enforcement officers authorized to carry firearms and to 235 |
|---|
| 2106 | + | make arrests for violations of the laws of the United States; 236 |
|---|
| 2107 | + | (33) "Misdemeanor", an offense so designated or an 237 |
|---|
| 2108 | + | offense for which persons found guilty thereof may be 238 |
|---|
| 2109 | + | sentenced to imprisonment for a term of which the maximum is 239 |
|---|
| 2110 | + | one year or less; 240 |
|---|
| 2111 | + | (34) "Of another", property that any entity, including 241 |
|---|
| 2112 | + | but not limited to any natural person, corporation, limited 242 |
|---|
| 2113 | + | liability company, partnership, association, governmental 243 |
|---|
| 2114 | + | subdivision or instrumentality, other than the actor, has a 244 |
|---|
| 2115 | + | possessory or proprietary intere st therein, except that 245 |
|---|
| 2116 | + | property shall not be deemed property of another who has 246 |
|---|
| 2117 | + | only a security interest therein, even if legal title is in 247 |
|---|
| 2118 | + | the creditor pursuant to a conditional sales contract or 248 |
|---|
| 2119 | + | other security arrangement; 249 |
|---|
| 2120 | + | (35) "Offense", any felony or misdemeanor; 250 |
|---|
| 2121 | + | (36) "Physical injury", slight impairment of any 251 |
|---|
| 2122 | + | function of the body or temporary loss of use of any part of 252 |
|---|
| 2123 | + | the body; 253 |
|---|
| 2124 | + | (37) "Place of confinement", any building or facility 254 |
|---|
| 2125 | + | and the grounds thereof wherein a court is l egally 255 |
|---|
| 2126 | + | authorized to order that a person charged with or convicted 256 |
|---|
| 2127 | + | of a crime be held; 257 |
|---|
| 2128 | + | 64 |
|---|
| 2129 | + | (38) "Possess" or "possessed", having actual or 258 |
|---|
| 2130 | + | constructive possession of an object with knowledge of its 259 |
|---|
| 2131 | + | presence. A person has actual possession if such pe rson has 260 |
|---|
| 2132 | + | the object on his or her person or within easy reach and 261 |
|---|
| 2133 | + | convenient control. A person has constructive possession if 262 |
|---|
| 2134 | + | such person has the power and the intention at a given time 263 |
|---|
| 2135 | + | to exercise dominion or control over the object either 264 |
|---|
| 2136 | + | directly or through another person or persons. Possession 265 |
|---|
| 2137 | + | may also be sole or joint. If one person alone has 266 |
|---|
| 2138 | + | possession of an object, possession is sole. If two or more 267 |
|---|
| 2139 | + | persons share possession of an object, possession is joint; 268 |
|---|
| 2140 | + | (39) "Property", anything of value, whether real or 269 |
|---|
| 2141 | + | personal, tangible or intangible, in possession or in action; 270 |
|---|
| 2142 | + | (40) "Public servant", any person employed in any way 271 |
|---|
| 2143 | + | by a government of this state who is compensated by the 272 |
|---|
| 2144 | + | government by reason of such person's employmen t, any person 273 |
|---|
| 2145 | + | appointed to a position with any government of this state, 274 |
|---|
| 2146 | + | or any person elected to a position with any government of 275 |
|---|
| 2147 | + | this state. It includes, but is not limited to, 276 |
|---|
| 2148 | + | legislators, jurors, members of the judiciary and law 277 |
|---|
| 2149 | + | enforcement officers. It does not include witnesses; 278 |
|---|
| 2150 | + | (41) "Purposely", when used with respect to a person's 279 |
|---|
| 2151 | + | conduct or to a result thereof, means when it is his or her 280 |
|---|
| 2152 | + | conscious object to engage in that conduct or to cause that 281 |
|---|
| 2153 | + | result; 282 |
|---|
| 2154 | + | (42) "Recklessly", consciously disregarding a 283 |
|---|
| 2155 | + | substantial and unjustifiable risk that circumstances exist 284 |
|---|
| 2156 | + | or that a result will follow, and such disregard constitutes 285 |
|---|
| 2157 | + | a gross deviation from the standard of care which a 286 |
|---|
| 2158 | + | reasonable person would exercise in the situation; 287 |
|---|
| 2159 | + | (43) "Serious emotional injury", an injury that 288 |
|---|
| 2160 | + | creates a substantial risk of temporary or permanent medical 289 |
|---|
| 2161 | + | or psychological damage, manifested by impairment of a 290 |
|---|
| 2162 | + | 65 |
|---|
| 2163 | + | behavioral, cognitive or physical condition. Serious 291 |
|---|
| 2164 | + | emotional injury shall be esta blished by testimony of 292 |
|---|
| 2165 | + | qualified experts upon the reasonable expectation of 293 |
|---|
| 2166 | + | probable harm to a reasonable degree of medical or 294 |
|---|
| 2167 | + | psychological certainty; 295 |
|---|
| 2168 | + | (44) "Serious physical injury", physical injury that 296 |
|---|
| 2169 | + | creates a substantial risk of death or t hat causes serious 297 |
|---|
| 2170 | + | disfigurement or protracted loss or impairment of the 298 |
|---|
| 2171 | + | function of any part of the body; 299 |
|---|
| 2172 | + | (45) "Services", when used in relation to a computer 300 |
|---|
| 2173 | + | system or network, means use of a computer, computer system, 301 |
|---|
| 2174 | + | or computer network and i ncludes, but is not limited to, 302 |
|---|
| 2175 | + | computer time, data processing, and storage or retrieval 303 |
|---|
| 2176 | + | functions; 304 |
|---|
| 2177 | + | (46) "Sexual orientation", male or female 305 |
|---|
| 2178 | + | heterosexuality, homosexuality or bisexuality by 306 |
|---|
| 2179 | + | inclination, practice, identity or expression, or havin g a 307 |
|---|
| 2180 | + | self-image or identity not traditionally associated with 308 |
|---|
| 2181 | + | one's gender; 309 |
|---|
| 2182 | + | (47) "Vehicle", a self-propelled mechanical device 310 |
|---|
| 2183 | + | designed to carry a person or persons, excluding vessels or 311 |
|---|
| 2184 | + | aircraft; 312 |
|---|
| 2185 | + | (48) "Vessel", any boat or craft propelled b y a motor 313 |
|---|
| 2186 | + | or by machinery, whether or not such motor or machinery is a 314 |
|---|
| 2187 | + | principal source of propulsion used or capable of being used 315 |
|---|
| 2188 | + | as a means of transportation on water, or any boat or craft 316 |
|---|
| 2189 | + | more than twelve feet in length which is powered by sail 317 |
|---|
| 2190 | + | alone or by a combination of sail and machinery, and used or 318 |
|---|
| 2191 | + | capable of being used as a means of transportation on water, 319 |
|---|
| 2192 | + | but not any boat or craft having, as the only means of 320 |
|---|
| 2193 | + | propulsion, a paddle or oars; 321 |
|---|
| 2194 | + | (49) "Voluntary act": 322 |
|---|
| 2195 | + | 66 |
|---|
| 2196 | + | (a) A bodily movement performed while conscious as a 323 |
|---|
| 2197 | + | result of effort or determination. Possession is a 324 |
|---|
| 2198 | + | voluntary act if the possessor knowingly procures or 325 |
|---|
| 2199 | + | receives the thing possessed, or having acquired control of 326 |
|---|
| 2200 | + | it was aware of his or her control for a suffici ent time to 327 |
|---|
| 2201 | + | have enabled him or her to dispose of it or terminate his or 328 |
|---|
| 2202 | + | her control; or 329 |
|---|
| 2203 | + | (b) An omission to perform an act of which the actor 330 |
|---|
| 2204 | + | is physically capable. A person is not guilty of an offense 331 |
|---|
| 2205 | + | based solely upon an omission to perform an act unless the 332 |
|---|
| 2206 | + | law defining the offense expressly so provides, or a duty to 333 |
|---|
| 2207 | + | perform the omitted act is otherwise imposed by law; 334 |
|---|
| 2208 | + | (50) "Vulnerable person", any person in the custody, 335 |
|---|
| 2209 | + | care, or control of the department of mental health who is 336 |
|---|
| 2210 | + | receiving services from an operated, funded, licensed, or 337 |
|---|
| 2211 | + | certified program. 338 |
|---|
| 2212 | + | 566.210. 1. A person commits the offense of sexual 1 |
|---|
| 2213 | + | trafficking of a child in the first degree if he or she 2 |
|---|
| 2214 | + | knowingly: 3 |
|---|
| 2215 | + | (1) Recruits, entices, harbors, t ransports, provides, 4 |
|---|
| 2216 | + | or obtains by any means, including but not limited to 5 |
|---|
| 2217 | + | through the use of force, abduction, coercion, fraud, 6 |
|---|
| 2218 | + | deception, blackmail, or causing or threatening to cause 7 |
|---|
| 2219 | + | financial harm, a person under the age of [twelve] fourteen 8 |
|---|
| 2220 | + | to participate in a commercial sex act, a sexual 9 |
|---|
| 2221 | + | performance, or the production of explicit sexual material 10 |
|---|
| 2222 | + | as defined in section 573.010, or benefits, financially or 11 |
|---|
| 2223 | + | by receiving anything of value, from participation in such 12 |
|---|
| 2224 | + | activities; 13 |
|---|
| 2225 | + | (2) Causes a person under the age of [twelve] fourteen 14 |
|---|
| 2226 | + | to engage in a commercial sex act, a sexual performance, or 15 |
|---|
| 2227 | + | the production of explicit sexual material as defined in 16 |
|---|
| 2228 | + | section 573.010; or 17 |
|---|
| 2229 | + | 67 |
|---|
| 2230 | + | (3) Advertises the availability of a person under the 18 |
|---|
| 2231 | + | age of [twelve] fourteen to participate in a commercial sex 19 |
|---|
| 2232 | + | act, a sexual performance, or the production of explicit 20 |
|---|
| 2233 | + | sexual material as defined in section 573.010. 21 |
|---|
| 2234 | + | 2. It shall not be a defense that the defendant 22 |
|---|
| 2235 | + | believed that the person was [twelve] fourteen years of age 23 |
|---|
| 2236 | + | or older. 24 |
|---|
| 2237 | + | 3. The offense of sexual trafficking of a child in the 25 |
|---|
| 2238 | + | first degree is a felony for which the authorized term of 26 |
|---|
| 2239 | + | imprisonment is life imprisonment without eligibility for 27 |
|---|
| 2240 | + | probation or parole until the offender has served not less 28 |
|---|
| 2241 | + | than [twenty-five] thirty years of such sentence. 29 |
|---|
| 2242 | + | Subsection 4 of section 558.019 shall not apply to the 30 |
|---|
| 2243 | + | sentence of a person who has been found guilty of sexual 31 |
|---|
| 2244 | + | trafficking of a child less than [twelve] fourteen years of 32 |
|---|
| 2245 | + | age, and "life impriso nment" shall mean imprisonment for the 33 |
|---|
| 2246 | + | duration of a person's natural life for the purposes of this 34 |
|---|
| 2247 | + | section. 35 |
|---|
| 2248 | + | 566.211. 1. A person commits the offense of sexual 1 |
|---|
| 2249 | + | trafficking of a child in the second degree if he or she 2 |
|---|
| 2250 | + | knowingly: 3 |
|---|
| 2251 | + | (1) Recruits, entices, harbors, transports, provides, 4 |
|---|
| 2252 | + | or obtains by any means, including but not limited to 5 |
|---|
| 2253 | + | through the use of force, abduction, coercion, fraud, 6 |
|---|
| 2254 | + | deception, blackmail, or causing or threatening to cause 7 |
|---|
| 2255 | + | financial harm, a person und er the age of eighteen to 8 |
|---|
| 2256 | + | participate in a commercial sex act, a sexual performance, 9 |
|---|
| 2257 | + | or the production of explicit sexual material as defined in 10 |
|---|
| 2258 | + | section 573.010, or benefits, financially or by receiving 11 |
|---|
| 2259 | + | anything of value, from participation in such act ivities; 12 |
|---|
| 2260 | + | (2) Causes a person under the age of eighteen to 13 |
|---|
| 2261 | + | engage in a commercial sex act, a sexual performance, or the 14 |
|---|
| 2262 | + | 68 |
|---|
| 2263 | + | production of explicit sexual material as defined in section 15 |
|---|
| 2264 | + | 573.010; or 16 |
|---|
| 2265 | + | (3) Advertises the availability of a person under the 17 |
|---|
| 2266 | + | age of eighteen to participate in a commercial sex act, a 18 |
|---|
| 2267 | + | sexual performance, or the production of explicit sexual 19 |
|---|
| 2268 | + | material as defined in section 573.010. 20 |
|---|
| 2269 | + | 2. It shall not be a defense that the defendant 21 |
|---|
| 2270 | + | believed that the person was eighteen years of age or older. 22 |
|---|
| 2271 | + | 3. The offense of sexual trafficking of a child in the 23 |
|---|
| 2272 | + | second degree is a felony punishable by imprisonment for a 24 |
|---|
| 2273 | + | term of years not less than [ten] twenty years or life and a 25 |
|---|
| 2274 | + | fine not to exceed two hundred fifty thousand dol lars if the 26 |
|---|
| 2275 | + | child is under the age of eighteen. If a violation of this 27 |
|---|
| 2276 | + | section was effected by force, abduction, or coercion, the 28 |
|---|
| 2277 | + | crime of sexual trafficking of a child shall be a felony for 29 |
|---|
| 2278 | + | which the authorized term of imprisonment is life 30 |
|---|
| 2279 | + | imprisonment without eligibility for probation or parole 31 |
|---|
| 2280 | + | until the defendant has served not less than twenty -five 32 |
|---|
| 2281 | + | years of such sentence. 33 |
|---|
| 2282 | + | 568.045. 1. A person commits the offense of 1 |
|---|
| 2283 | + | endangering the welfare of a child in the first degree if he 2 |
|---|
| 2284 | + | or she: 3 |
|---|
| 2285 | + | (1) Knowingly acts in a manner that creates a 4 |
|---|
| 2286 | + | substantial risk to the life, body, or health of a child 5 |
|---|
| 2287 | + | less than seventeen years of age; [or] 6 |
|---|
| 2288 | + | (2) Knowingly engages in sexual conduct with a person 7 |
|---|
| 2289 | + | under the age of seventeen years over whom the person is a 8 |
|---|
| 2290 | + | parent, guardian, or otherwise charged with the care and 9 |
|---|
| 2291 | + | custody; 10 |
|---|
| 2292 | + | (3) Knowingly encourages, aids or causes a child less 11 |
|---|
| 2293 | + | than seventeen years of age to engage in any conduct which 12 |
|---|
| 2294 | + | violates the provisions of chapter 571 o r 579; or 13 |
|---|
| 2295 | + | 69 |
|---|
| 2296 | + | (4) In the presence of a child less than seventeen 14 |
|---|
| 2297 | + | years of age or in a residence where a child less than 15 |
|---|
| 2298 | + | seventeen years of age resides, unlawfully manufactures or 16 |
|---|
| 2299 | + | attempts to manufacture compounds, possesses, produces, 17 |
|---|
| 2300 | + | prepares, sells, transports, tests or analyzes any of the 18 |
|---|
| 2301 | + | following: fentanyl, carfentanil, amphetamine, or 19 |
|---|
| 2302 | + | methamphetamine, or any [of its analogues] analogue thereof. 20 |
|---|
| 2303 | + | 2. The offense of endangering the welfare of a child 21 |
|---|
| 2304 | + | in the first degree is a class D felony unless the offense: 22 |
|---|
| 2305 | + | (1) Is committed as part of an act or series of acts 23 |
|---|
| 2306 | + | performed by two or more persons as part of an established 24 |
|---|
| 2307 | + | or prescribed pattern of activity, or where physical injury 25 |
|---|
| 2308 | + | to the child results, or the offense is a second or 26 |
|---|
| 2309 | + | subsequent offense under this section, in which case the 27 |
|---|
| 2310 | + | offense is a class C felony; 28 |
|---|
| 2311 | + | (2) Involves fentanyl or carfentanil, or any analogue 29 |
|---|
| 2312 | + | thereof, in which case: 30 |
|---|
| 2313 | + | (a) The offense is a class B felony; and 31 |
|---|
| 2314 | + | (b) A person sentenced under this subdivision shall 32 |
|---|
| 2315 | + | not be eligible for conditional release or parole until he 33 |
|---|
| 2316 | + | or she has served at least five years of imprisonment; 34 |
|---|
| 2317 | + | (3) Results in serious physical injury to the child, 35 |
|---|
| 2318 | + | in which case the offense is a class B felony; or 36 |
|---|
| 2319 | + | [(3)] (4) Results in the death of a child, in which 37 |
|---|
| 2320 | + | case the offense is a class A felony. 38 |
|---|
| 2321 | + | 570.030. 1. A person commits the offense of stealing 1 |
|---|
| 2322 | + | if he or she: 2 |
|---|
| 2323 | + | (1) Appropriates property or services of another with 3 |
|---|
| 2324 | + | the purpose to deprive him or her thereof, either without 4 |
|---|
| 2325 | + | his or her consent or by means of deceit or coercion; 5 |
|---|
| 2326 | + | (2) Attempts to appropriate anhydrous ammonia or 6 |
|---|
| 2327 | + | liquid nitrogen of another with the purpose to deprive him 7 |
|---|
| 2328 | + | 70 |
|---|
| 2329 | + | or her thereof, either without his or her con sent or by 8 |
|---|
| 2330 | + | means of deceit or coercion; or 9 |
|---|
| 2331 | + | (3) For the purpose of depriving the owner of a lawful 10 |
|---|
| 2332 | + | interest therein, receives, retains or disposes of property 11 |
|---|
| 2333 | + | of another knowing that it has been stolen, or believing 12 |
|---|
| 2334 | + | that it has been stolen. 13 |
|---|
| 2335 | + | 2. The offense of stealing is a class A felony if the 14 |
|---|
| 2336 | + | property appropriated consists of any of the following 15 |
|---|
| 2337 | + | containing any amount of anhydrous ammonia: a tank truck, 16 |
|---|
| 2338 | + | tank trailer, rail tank car, bulk storage tank, field nurse, 17 |
|---|
| 2339 | + | field tank or field app licator. 18 |
|---|
| 2340 | + | 3. The offense of stealing is a class B felony if: 19 |
|---|
| 2341 | + | (1) The property appropriated or attempted to be 20 |
|---|
| 2342 | + | appropriated consists of any amount of anhydrous ammonia or 21 |
|---|
| 2343 | + | liquid nitrogen; 22 |
|---|
| 2344 | + | (2) The property consists of any animal considered 23 |
|---|
| 2345 | + | livestock as the term livestock is defined in section 24 |
|---|
| 2346 | + | 144.010, or any captive wildlife held under permit issued by 25 |
|---|
| 2347 | + | the conservation commission, and the value of the animal or 26 |
|---|
| 2348 | + | animals appropriated exceeds three thousand dollars and that 27 |
|---|
| 2349 | + | person has previously been found guilty of appropriating any 28 |
|---|
| 2350 | + | animal considered livestock or captive wildlife held under 29 |
|---|
| 2351 | + | permit issued by the conservation commission. 30 |
|---|
| 2352 | + | Notwithstanding any provision of law to the contrary, such 31 |
|---|
| 2353 | + | person shall serve a minimum prison term of not less than 32 |
|---|
| 2354 | + | eighty percent of his or her sentence before he or she is 33 |
|---|
| 2355 | + | eligible for probation, parole, conditional release, or 34 |
|---|
| 2356 | + | other early release by the department of corrections; 35 |
|---|
| 2357 | + | (3) A person appropriates property consisting of a 36 |
|---|
| 2358 | + | motor vehicle, watercraft, or aircraft, and that person has 37 |
|---|
| 2359 | + | previously been found guilty of two stealing -related 38 |
|---|
| 2360 | + | offenses committed on two separate occasions where such 39 |
|---|
| 2361 | + | 71 |
|---|
| 2362 | + | offenses occurred within ten years of the date of occurrence 40 |
|---|
| 2363 | + | of the present offense; 41 |
|---|
| 2364 | + | (4) The property appropriated or attempted to be 42 |
|---|
| 2365 | + | appropriated consists of any animal considered livestock as 43 |
|---|
| 2366 | + | the term is defined in section 144.010 if the value of the 44 |
|---|
| 2367 | + | livestock exceeds ten thousand dollars; [or] 45 |
|---|
| 2368 | + | (5) The property appropriated or at tempted to be 46 |
|---|
| 2369 | + | appropriated is owned by or in the custody of a financial 47 |
|---|
| 2370 | + | institution and the property is taken or attempted to be 48 |
|---|
| 2371 | + | taken physically from an individual person to deprive the 49 |
|---|
| 2372 | + | owner or custodian of the property ; or 50 |
|---|
| 2373 | + | (6) The person appropriates property, the person's 51 |
|---|
| 2374 | + | course of conduct is part of an organized retail theft, and 52 |
|---|
| 2375 | + | the value of the property taken, combined with any property 53 |
|---|
| 2376 | + | damage inflicted in such theft, is ten thousand dollars or 54 |
|---|
| 2377 | + | more. 55 |
|---|
| 2378 | + | 4. The offense of stealing is a class C felony if: 56 |
|---|
| 2379 | + | (1) The value of the property or services appropriated 57 |
|---|
| 2380 | + | is twenty-five thousand dollars or more [or]; 58 |
|---|
| 2381 | + | (2) The property is a teller machine or the contents 59 |
|---|
| 2382 | + | of a teller machine, including cash, regardless of the value 60 |
|---|
| 2383 | + | or amount; or 61 |
|---|
| 2384 | + | (3) The person appropriates property, the person's 62 |
|---|
| 2385 | + | course of conduct is part of an organized retail theft, and 63 |
|---|
| 2386 | + | the value of the property taken, combined with any property 64 |
|---|
| 2387 | + | damage inflicted in such theft, is seven hundred fifty 65 |
|---|
| 2388 | + | dollars or more but less than ten thousand dollars . 66 |
|---|
| 2389 | + | 5. The offense of stealing is a class D felony if: 67 |
|---|
| 2390 | + | (1) The value of the property or services appropriated 68 |
|---|
| 2391 | + | is seven hundred fifty dollars or more; 69 |
|---|
| 2392 | + | (2) The offender physically takes the property 70 |
|---|
| 2393 | + | appropriated from the person of the victim; or 71 |
|---|
| 2394 | + | (3) The property appropriated consists of: 72 |
|---|
| 2395 | + | 72 |
|---|
| 2396 | + | (a) Any motor vehicle, watercraft or aircraft; 73 |
|---|
| 2397 | + | (b) Any will or unrecorded deed affecting real 74 |
|---|
| 2398 | + | property; 75 |
|---|
| 2399 | + | (c) Any credit device, debit device or letter of 76 |
|---|
| 2400 | + | credit; 77 |
|---|
| 2401 | + | (d) Any firearms; 78 |
|---|
| 2402 | + | (e) Any explosive weapon as defined in section 571.010; 79 |
|---|
| 2403 | + | (f) Any United States national flag designed, intended 80 |
|---|
| 2404 | + | and used for display on buildings or stationary flagstaffs 81 |
|---|
| 2405 | + | in the open; 82 |
|---|
| 2406 | + | (g) Any original copy of an act, bill or resolution, 83 |
|---|
| 2407 | + | introduced or acted upon by the legislature of the state of 84 |
|---|
| 2408 | + | Missouri; 85 |
|---|
| 2409 | + | (h) Any pleading, notice, judgment or any other record 86 |
|---|
| 2410 | + | or entry of any court of this state, any other state or of 87 |
|---|
| 2411 | + | the United States; 88 |
|---|
| 2412 | + | (i) Any book of registration or list of voters 89 |
|---|
| 2413 | + | required by chapter 115; 90 |
|---|
| 2414 | + | (j) Any animal considered livestock as that term is 91 |
|---|
| 2415 | + | defined in section 144.010; 92 |
|---|
| 2416 | + | (k) Any live fish raised for commercial sale with a 93 |
|---|
| 2417 | + | value of seventy-five dollars or more; 94 |
|---|
| 2418 | + | (l) Any captive wildlife held under permit issued by 95 |
|---|
| 2419 | + | the conservation commission; 96 |
|---|
| 2420 | + | (m) Any controlled substance as defined by section 97 |
|---|
| 2421 | + | 195.010; 98 |
|---|
| 2422 | + | (n) Ammonium nitrate; 99 |
|---|
| 2423 | + | (o) Any wire, electrical transformer, or metallic wire 100 |
|---|
| 2424 | + | associated with transmitting telecommunications, video, 101 |
|---|
| 2425 | + | internet, or voice over internet protocol service, or any 102 |
|---|
| 2426 | + | other device or pipe that is associated with conducting 103 |
|---|
| 2427 | + | electricity or transporting natural gas or other combustible 104 |
|---|
| 2428 | + | fuels; or 105 |
|---|
| 2429 | + | 73 |
|---|
| 2430 | + | (p) Any material appropriated with the intent to use 106 |
|---|
| 2431 | + | such material to manufacture, compound, produce, prepare, 107 |
|---|
| 2432 | + | test or analyze amphetamine or methamphetamine or any of 108 |
|---|
| 2433 | + | their analogues. 109 |
|---|
| 2434 | + | 6. The offense of stealing is a class E felony if: 110 |
|---|
| 2435 | + | (1) The property appropriated is an animal; 111 |
|---|
| 2436 | + | (2) The property is a catalytic converter; 112 |
|---|
| 2437 | + | (3) A person has previously been found guilty of three 113 |
|---|
| 2438 | + | stealing-related offenses committed on three separate 114 |
|---|
| 2439 | + | occasions where such offenses occurred within ten years of 115 |
|---|
| 2440 | + | the date of occurrence of the present offense; or 116 |
|---|
| 2441 | + | (4) The property appropriated is a letter, postal 117 |
|---|
| 2442 | + | card, package, bag, or other sealed article that was 118 |
|---|
| 2443 | + | delivered by a common carrier or delivery service and not 119 |
|---|
| 2444 | + | yet received by the addressee o r that had been left to be 120 |
|---|
| 2445 | + | collected for shipment by a common carrier or delivery 121 |
|---|
| 2446 | + | service. 122 |
|---|
| 2447 | + | 7. The offense of stealing is a class D misdemeanor if 123 |
|---|
| 2448 | + | the property is not of a type listed in subsection 2, 3, 5, 124 |
|---|
| 2449 | + | or 6 of this section, the property appro priated has a value 125 |
|---|
| 2450 | + | of less than one hundred fifty dollars, and the person has 126 |
|---|
| 2451 | + | no previous findings of guilt for a stealing -related offense. 127 |
|---|
| 2452 | + | 8. The offense of stealing is a class A misdemeanor if 128 |
|---|
| 2453 | + | no other penalty is specified in this section. 129 |
|---|
| 2454 | + | 9. If a violation of this section is subject to 130 |
|---|
| 2455 | + | enhanced punishment based on prior findings of guilt, such 131 |
|---|
| 2456 | + | findings of guilt shall be pleaded and proven in the same 132 |
|---|
| 2457 | + | manner as required by section 558.021. 133 |
|---|
| 2458 | + | 10. The appropriation of any property or services of a 134 |
|---|
| 2459 | + | type listed in subsection 2, 3, 5, or 6 of this section or 135 |
|---|
| 2460 | + | of a value of seven hundred fifty dollars or more may be 136 |
|---|
| 2461 | + | considered a separate felony and may be charged in separate 137 |
|---|
| 2462 | + | counts. 138 |
|---|
| 2463 | + | 74 |
|---|
| 2464 | + | 11. The value of property or services appropriat ed 139 |
|---|
| 2465 | + | pursuant to one scheme or course of conduct, whether from 140 |
|---|
| 2466 | + | the same or several owners and whether at the same or 141 |
|---|
| 2467 | + | different times, constitutes a single criminal episode and 142 |
|---|
| 2468 | + | may be aggregated in determining the grade of the offense, 143 |
|---|
| 2469 | + | except as set forth in subsection 10 of this section. 144 |
|---|
| 2470 | + | 12. As used in this section, the term "organized 145 |
|---|
| 2471 | + | retail theft" means: 146 |
|---|
| 2472 | + | (1) Any act of stealing committed by one or more 147 |
|---|
| 2473 | + | persons, as part of any agreement to steal property from any 148 |
|---|
| 2474 | + | business, and separate ac ts of stealing that are part of any 149 |
|---|
| 2475 | + | ongoing agreement to steal may be aggregated for the purpose 150 |
|---|
| 2476 | + | of determining value regardless of whether such acts are 151 |
|---|
| 2477 | + | committed in the same jurisdiction or at the same time; 152 |
|---|
| 2478 | + | (2) Any act of receiving or possessin g any property 153 |
|---|
| 2479 | + | that has been taken or stolen in violation of subdivision 154 |
|---|
| 2480 | + | (1) of this subsection while knowing or having reasonable 155 |
|---|
| 2481 | + | grounds to believe the property is stolen from any business 156 |
|---|
| 2482 | + | in violation of this section, and separate acts of receiving 157 |
|---|
| 2483 | + | or possessing such stolen property that are part of any 158 |
|---|
| 2484 | + | ongoing agreement to receive or possess such stolen property 159 |
|---|
| 2485 | + | may be aggregated for the purpose of determining value 160 |
|---|
| 2486 | + | regardless of whether such acts are committed in the same 161 |
|---|
| 2487 | + | jurisdiction or at th e same time; or 162 |
|---|
| 2488 | + | (3) Any act of organizing, supervising, financing, 163 |
|---|
| 2489 | + | leading, or managing between one or more persons to engage 164 |
|---|
| 2490 | + | for profit in a scheme or course of conduct to effectuate or 165 |
|---|
| 2491 | + | intend to effectuate the transfer or sale of property stolen 166 |
|---|
| 2492 | + | from any business in violation of this section, and separate 167 |
|---|
| 2493 | + | acts of organizing, supervising, financing, leading, or 168 |
|---|
| 2494 | + | managing between one or more persons to engage for profit in 169 |
|---|
| 2495 | + | a scheme or course of conduct to effectuate or intend to 170 |
|---|
| 2496 | + | effectuate the transfer or sale of such stolen property that 171 |
|---|
| 2497 | + | 75 |
|---|
| 2498 | + | are part of any ongoing agreement to organize, supervise, 172 |
|---|
| 2499 | + | finance, lead, or manage between one or more persons to 173 |
|---|
| 2500 | + | engage for profit in a scheme or course of conduct to 174 |
|---|
| 2501 | + | effectuate or intend to effectuate the transfer or sale of 175 |
|---|
| 2502 | + | such stolen property may be aggregated for the purpose of 176 |
|---|
| 2503 | + | determining the value regardless of whether such acts are 177 |
|---|
| 2504 | + | committed in the same jurisdiction or at the same time. 178 |
|---|
| 2505 | + | 13. If any prosecuting attorney or circuit attorney 179 |
|---|
| 2506 | + | makes a request in writing to the attorney general, the 180 |
|---|
| 2507 | + | attorney general shall have the authority to commence and 181 |
|---|
| 2508 | + | prosecute the offense of stealing if such offense involves 182 |
|---|
| 2509 | + | organized retail theft, and any other offenses that directly 183 |
|---|
| 2510 | + | arise from or causally occur as a result of an alleged 184 |
|---|
| 2511 | + | violation of the offense of stealing involving organized 185 |
|---|
| 2512 | + | retail theft, in each or any county or a city not within a 186 |
|---|
| 2513 | + | county in which the offense occurred with the same power and 187 |
|---|
| 2514 | + | authority granted to prosecuting attorn eys in section 56.060 188 |
|---|
| 2515 | + | and circuit attorneys in section 56.450, except that all 189 |
|---|
| 2516 | + | costs and fees of such prosecution by the attorney general 190 |
|---|
| 2517 | + | shall be paid by the state and not by any county or local 191 |
|---|
| 2518 | + | government. 192 |
|---|
| 2519 | + | 14. No provision of this section shall grant any 193 |
|---|
| 2520 | + | additional power to the attorney general beyond commencement 194 |
|---|
| 2521 | + | and prosecution of offenses as authorized in this section. 195 |
|---|
| 2522 | + | 575.133. 1. A person commits the offense of filing a 1 |
|---|
| 2523 | + | nonconsensual common law lien if he or she fil es a document 2 |
|---|
| 2524 | + | that purports to assert a lien against the assets, real or 3 |
|---|
| 2525 | + | personal, of any person and that, regardless of any self - 4 |
|---|
| 2526 | + | description: 5 |
|---|
| 2527 | + | (1) Is not expressly provided for by a specific state 6 |
|---|
| 2528 | + | or federal statute; 7 |
|---|
| 2529 | + | 76 |
|---|
| 2530 | + | (2) Does not depend upon the consent of the owner of 8 |
|---|
| 2531 | + | the property affected or the existence of a contract for its 9 |
|---|
| 2532 | + | existence; and 10 |
|---|
| 2533 | + | (3) Is not an equitable or constructive lien imposed 11 |
|---|
| 2534 | + | by a state or federal court of competent jurisdiction. 12 |
|---|
| 2535 | + | 2. This section shall not a pply to a filing officer as 13 |
|---|
| 2536 | + | defined in section 428.105 that is acting in the scope of 14 |
|---|
| 2537 | + | his or her employment. 15 |
|---|
| 2538 | + | 3. The offense of filing a nonconsensual common law 16 |
|---|
| 2539 | + | lien is a class B misdemeanor , unless it is a second 17 |
|---|
| 2540 | + | offense, in which case it is a c lass A misdemeanor. Any 18 |
|---|
| 2541 | + | third or subsequent offense of filing a nonconsensual common 19 |
|---|
| 2542 | + | law lien is a class E felony. Any person convicted of a 20 |
|---|
| 2543 | + | third or subsequent offense of filing a nonconsensual common 21 |
|---|
| 2544 | + | law lien shall be considered a persistent offend er, as such 22 |
|---|
| 2545 | + | term is defined in section 558.016 . 23 |
|---|
| 2546 | + | 575.150. 1. A person commits the offense of resisting 1 |
|---|
| 2547 | + | or interfering with arrest, detention, or stop if he or she 2 |
|---|
| 2548 | + | knows or reasonably should know that a law enforcement 3 |
|---|
| 2549 | + | officer is making an arrest or attempting to lawfully detain 4 |
|---|
| 2550 | + | or stop an individual or vehicle, and for the purpose of 5 |
|---|
| 2551 | + | preventing the officer from effecting the arrest, stop or 6 |
|---|
| 2552 | + | detention, he or she: 7 |
|---|
| 2553 | + | (1) Resists the arrest, stop or detention of such 8 |
|---|
| 2554 | + | person by using or threatening the use of violence or 9 |
|---|
| 2555 | + | physical force or by fleeing from such officer; or 10 |
|---|
| 2556 | + | (2) Interferes with the arrest, stop or detention of 11 |
|---|
| 2557 | + | another person by using or threatening the use of violence, 12 |
|---|
| 2558 | + | physical force or physical interference . 13 |
|---|
| 2559 | + | 2. This section applies to: 14 |
|---|
| 2560 | + | (1) Arrests, stops, or detentions, with or without 15 |
|---|
| 2561 | + | warrants; 16 |
|---|
| 2562 | + | 77 |
|---|
| 2563 | + | (2) Arrests, stops, or detentions, for any offense, 17 |
|---|
| 2564 | + | infraction, or ordinance violation; and 18 |
|---|
| 2565 | + | (3) Arrests for warrants issued by a court or a 19 |
|---|
| 2566 | + | probation and parole officer. 20 |
|---|
| 2567 | + | 3. A person is presumed to be fleeing a vehicle stop 21 |
|---|
| 2568 | + | if he or she continues to operate a motor vehicle after he 22 |
|---|
| 2569 | + | or she has seen or should have seen clearly visible 23 |
|---|
| 2570 | + | emergency lights or has heard or should have heard an 24 |
|---|
| 2571 | + | audible signal emanating from the law enforcement vehicle 25 |
|---|
| 2572 | + | pursuing him or her. 26 |
|---|
| 2573 | + | 4. It is no defense to a prosecution pursuant to 27 |
|---|
| 2574 | + | subsection 1 of this section that the law enforcement 28 |
|---|
| 2575 | + | officer was acting unlawfully in making the arrest. 29 |
|---|
| 2576 | + | However, nothing in this section shall be construed to bar 30 |
|---|
| 2577 | + | civil suits for unlawful arrest. 31 |
|---|
| 2578 | + | 5. The offense of resisting or interfering with an 32 |
|---|
| 2579 | + | arrest is a class E felony for an arrest for a: 33 |
|---|
| 2580 | + | (1) Felony; 34 |
|---|
| 2581 | + | (2) Warrant issued for failure to appear on a felony 35 |
|---|
| 2582 | + | case; or 36 |
|---|
| 2583 | + | (3) Warrant issued for a probation violation on a 37 |
|---|
| 2584 | + | felony case. 38 |
|---|
| 2585 | + | The offense of resisting an arrest, detention or stop in 39 |
|---|
| 2586 | + | violation of subdivision (1) or (2) of subsection 1 of this 40 |
|---|
| 2587 | + | section is a class A misdemeanor, unless t he person fleeing 41 |
|---|
| 2588 | + | creates a substantial risk of serious physical injury or 42 |
|---|
| 2589 | + | death to any person, in which case it is a class E felony. 43 |
|---|
| 2590 | + | 6. In the case of a conviction or a plea of guilty 44 |
|---|
| 2591 | + | under this section that is subject to punishment as a class 45 |
|---|
| 2592 | + | E felony, any vehicle used in violation of this section may 46 |
|---|
| 2593 | + | be impounded and forfeited pursuant to section 82.1000 and 47 |
|---|
| 2594 | + | sections 513.600 to 513.645. 48 |
|---|
| 2595 | + | 78 |
|---|
| 2596 | + | 576.030. 1. A person commits the offense of 1 |
|---|
| 2597 | + | obstructing government operations if he or she purposely 2 |
|---|
| 2598 | + | obstructs, impairs, hinders or perverts the performance of a 3 |
|---|
| 2599 | + | governmental function by the use or threat of violence, 4 |
|---|
| 2600 | + | force, or other physical interference or obstacle. 5 |
|---|
| 2601 | + | 2. The offense of obstructing government operations is 6 |
|---|
| 2602 | + | a class B misdemeanor. The offense of obstructing 7 |
|---|
| 2603 | + | government operations is a class A misdemeanor if the person 8 |
|---|
| 2604 | + | uses violence or force. 9 |
|---|
| 2605 | + | 577.150. 1. A person commits the offense of tampering 1 |
|---|
| 2606 | + | with a water supply if he or she purposely: 2 |
|---|
| 2607 | + | (1) Poisons, defiles, or in any way corrupts the water 3 |
|---|
| 2608 | + | of a well, spring, brook , or reservoir used for domestic or 4 |
|---|
| 2609 | + | municipal purposes; or 5 |
|---|
| 2610 | + | (2) Diverts, dams up, and holds back from its natural 6 |
|---|
| 2611 | + | course and flow any spring, brook , or other water supply for 7 |
|---|
| 2612 | + | domestic or municipal purposes, after said water supply 8 |
|---|
| 2613 | + | shall have once been taken for use by any person or persons, 9 |
|---|
| 2614 | + | corporation, town, or city for their use. 10 |
|---|
| 2615 | + | 2. The offense of tampering with a water supply is a 11 |
|---|
| 2616 | + | class E felony when the offense is a violation of 12 |
|---|
| 2617 | + | subdivision (1) of subsection 1 of this section and is a 13 |
|---|
| 2618 | + | class A misdemeanor when the offense is a violation of 14 |
|---|
| 2619 | + | subdivision (2) of subsection 1 of this section . 15 |
|---|
| 2620 | + | 590.040. 1. The POST commission shall set the minimum 1 |
|---|
| 2621 | + | number of hours of basic training for licensure as a peace 2 |
|---|
| 2622 | + | officer no lower than six hundred, with the following 3 |
|---|
| 2623 | + | exceptions: 4 |
|---|
| 2624 | + | (1) Up to one thousand hours may be mandated for any 5 |
|---|
| 2625 | + | class of license required for commission by a state law 6 |
|---|
| 2626 | + | enforcement agency; 7 |
|---|
| 2627 | + | (2) As few as one hundred twenty hours may be mandated 8 |
|---|
| 2628 | + | for any class of license restricted to commission as a 9 |
|---|
| 2629 | + | 79 |
|---|
| 2630 | + | reserve peace officer with police powers limited to the 10 |
|---|
| 2631 | + | commissioning political subdivision; 11 |
|---|
| 2632 | + | (3) Persons validly licensed on August 28, 2001, may 12 |
|---|
| 2633 | + | retain licensure without additional basic training; 13 |
|---|
| 2634 | + | (4) Persons licensed and commissioned within a county 14 |
|---|
| 2635 | + | of the third classification before July 1, 2002, may retain 15 |
|---|
| 2636 | + | licensure with one hundred twenty hours of ba sic training if 16 |
|---|
| 2637 | + | the commissioning political subdivision has adopted an order 17 |
|---|
| 2638 | + | or ordinance to that effect; 18 |
|---|
| 2639 | + | (5) Persons serving as a reserve officer on August 27, 19 |
|---|
| 2640 | + | 2001, within a county of the first classification or a 20 |
|---|
| 2641 | + | county with a charter form of government and with more than 21 |
|---|
| 2642 | + | one million inhabitants on August 27, 2001, having 22 |
|---|
| 2643 | + | previously completed a minimum of one hundred sixty hours of 23 |
|---|
| 2644 | + | training, shall be granted a license necessary to function 24 |
|---|
| 2645 | + | as a reserve peace officer only within such county. For the 25 |
|---|
| 2646 | + | purposes of this subdivision, the term "reserve officer" 26 |
|---|
| 2647 | + | shall mean any person who serves in a less than full -time 27 |
|---|
| 2648 | + | law enforcement capacity, with or without pay and who, 28 |
|---|
| 2649 | + | without certification, has no power of arrest and who, 29 |
|---|
| 2650 | + | without certification, must be under the direct and 30 |
|---|
| 2651 | + | immediate accompaniment of a certified peace officer of the 31 |
|---|
| 2652 | + | same agency at all times while on duty; and 32 |
|---|
| 2653 | + | (6) The POST commission shall provide for the 33 |
|---|
| 2654 | + | recognition of basic training received at law enforcement 34 |
|---|
| 2655 | + | training centers of other states, the military, the federal 35 |
|---|
| 2656 | + | government and territories of the United States regardless 36 |
|---|
| 2657 | + | of the number of hours included in such training and shall 37 |
|---|
| 2658 | + | have authority to require supplemental training as a 38 |
|---|
| 2659 | + | condition of eligibilit y for licensure. 39 |
|---|
| 2660 | + | 2. The director shall have the authority to limit any 40 |
|---|
| 2661 | + | exception provided in subsection 1 of this section to 41 |
|---|
| 2662 | + | 80 |
|---|
| 2663 | + | persons remaining in the same commission or transferring to 42 |
|---|
| 2664 | + | a commission in a similar jurisdiction. 43 |
|---|
| 2665 | + | 3. The basic training of every peace officer, except 44 |
|---|
| 2666 | + | agents of the conservation commission, shall include at 45 |
|---|
| 2667 | + | least thirty hours of training in the investigation and 46 |
|---|
| 2668 | + | management of cases involving domestic and family violence. 47 |
|---|
| 2669 | + | Such training shall include instruction, s pecific to 48 |
|---|
| 2670 | + | domestic and family violence cases, regarding: report 49 |
|---|
| 2671 | + | writing; physical abuse, sexual abuse, child fatalities and 50 |
|---|
| 2672 | + | child neglect; interviewing children and alleged 51 |
|---|
| 2673 | + | perpetrators; the nature, extent and causes of domestic and 52 |
|---|
| 2674 | + | family violence; the safety of victims, other family and 53 |
|---|
| 2675 | + | household members and investigating officers; legal rights 54 |
|---|
| 2676 | + | and remedies available to victims, including rights to 55 |
|---|
| 2677 | + | compensation and the enforcement of civil and criminal 56 |
|---|
| 2678 | + | remedies; services available to victims an d their children; 57 |
|---|
| 2679 | + | the effects of cultural, racial and gender bias in law 58 |
|---|
| 2680 | + | enforcement; and state statutes. Said curriculum shall be 59 |
|---|
| 2681 | + | developed and presented in consultation with the department 60 |
|---|
| 2682 | + | of health and senior services, the children's division, 61 |
|---|
| 2683 | + | public and private providers of programs for victims of 62 |
|---|
| 2684 | + | domestic and family violence, persons who have demonstrated 63 |
|---|
| 2685 | + | expertise in training and education concerning domestic and 64 |
|---|
| 2686 | + | family violence, and the Missouri coalition against domestic 65 |
|---|
| 2687 | + | violence. 66 |
|---|
| 2688 | + | 4. The basic training of every peace officer first 67 |
|---|
| 2689 | + | licensed on or after August 28, 2027, shall include at least 68 |
|---|
| 2690 | + | six hours of training concerning the prohibition against 69 |
|---|
| 2691 | + | racial profiling and such training shall promote 70 |
|---|
| 2692 | + | understanding and respect for racial and cultural 71 |
|---|
| 2693 | + | differences and the use of effective, noncombative methods 72 |
|---|
| 2694 | + | for carrying out law enforcement duties in a racially and 73 |
|---|
| 2695 | + | culturally diverse environment. Such training shall include 74 |
|---|
| 2696 | + | 81 |
|---|
| 2697 | + | two hours of racial profiling training, two hours of 75 |
|---|
| 2698 | + | implicit bias training, and two hours of de -escalation 76 |
|---|
| 2699 | + | training. 77 |
|---|
| 2700 | + | 590.208. 1. There is hereby established the 1 |
|---|
| 2701 | + | "Committee on School Safety" within the department of public 2 |
|---|
| 2702 | + | safety. 3 |
|---|
| 2703 | + | 2. The committee shall consist of the following 4 |
|---|
| 2704 | + | members: 5 |
|---|
| 2705 | + | (1) Up to three representatives of the department of 6 |
|---|
| 2706 | + | public safety; 7 |
|---|
| 2707 | + | (2) A representative of the Missouri Sheriff's 8 |
|---|
| 2708 | + | Association; 9 |
|---|
| 2709 | + | (3) A representative of the Missouri Municipal League; 10 |
|---|
| 2710 | + | (4) A representative of the department of elementary 11 |
|---|
| 2711 | + | and secondary education; and 12 |
|---|
| 2712 | + | (5) A representative of the Missouri School Boards' 13 |
|---|
| 2713 | + | Association's Center for Education Safety. 14 |
|---|
| 2714 | + | 3. One member who represents the department of public 15 |
|---|
| 2715 | + | safety shall serve as chair of the committee. 16 |
|---|
| 2716 | + | 4. Members of the committee shall serve without 17 |
|---|
| 2717 | + | compensation but may be reimbursed for actual expenses 18 |
|---|
| 2718 | + | necessary to the performance of their official duties for 19 |
|---|
| 2719 | + | the committee. 20 |
|---|
| 2720 | + | 5. The committee shall meet at least four times per 21 |
|---|
| 2721 | + | year, and at least once per calendar quarter, to evaluate 22 |
|---|
| 2722 | + | and establish guidelines for school safety concerns, 23 |
|---|
| 2723 | + | including plans to prevent school firearm violence. 24 |
|---|
| 2724 | + | 6. Except as provided in section 610.021, all meetings 25 |
|---|
| 2725 | + | of the committee shall be open to the public. 26 |
|---|
| 2726 | + | 7. The committee shall submit an annual report in 27 |
|---|
| 2727 | + | writing to the governor, president pro tempore of the 28 |
|---|
| 2728 | + | senate, and speaker of the house of representatives. 29 |
|---|
| 2729 | + | 82 |
|---|
| 2730 | + | 595.209. 1. The following rights shall automatically 1 |
|---|
| 2731 | + | be afforded to victims of dangerous felonies, as defined in 2 |
|---|
| 2732 | + | section 556.061, victims of murder in the first degree, as 3 |
|---|
| 2733 | + | defined in section 565.020, victims of voluntary 4 |
|---|
| 2734 | + | manslaughter, as defined in section 565.023, victims of any 5 |
|---|
| 2735 | + | offense under chapter 566, victims of an attempt to commit 6 |
|---|
| 2736 | + | one of the preceding crimes, as defined in section 562.012, 7 |
|---|
| 2737 | + | and victims of domestic assault, as defined in sections 8 |
|---|
| 2738 | + | 565.072 to 565.076; and, upon written request, the following 9 |
|---|
| 2739 | + | rights shall be afforded to victims of all other crime s and 10 |
|---|
| 2740 | + | witnesses of crimes: 11 |
|---|
| 2741 | + | (1) For victims, the right to be present at all 12 |
|---|
| 2742 | + | criminal justice proceedings at which the defendant has such 13 |
|---|
| 2743 | + | right, including juvenile proceedings where the offense 14 |
|---|
| 2744 | + | would have been a felony if committed by an adult, eve n if 15 |
|---|
| 2745 | + | the victim is called to testify or may be called to testify 16 |
|---|
| 2746 | + | as a witness in the case; 17 |
|---|
| 2747 | + | (2) For victims, the right to information about the 18 |
|---|
| 2748 | + | crime, as provided for in subdivision (5) of this subsection; 19 |
|---|
| 2749 | + | (3) For victims and witnesses, to be informed, in a 20 |
|---|
| 2750 | + | timely manner, by the prosecutor's office of the filing of 21 |
|---|
| 2751 | + | charges, preliminary hearing dates, trial dates, 22 |
|---|
| 2752 | + | continuances and the final disposition of the case. Final 23 |
|---|
| 2753 | + | disposition information shall be provided within five days; 24 |
|---|
| 2754 | + | (4) For victims, the right to confer with and to be 25 |
|---|
| 2755 | + | informed by the prosecutor regarding bail hearings, guilty 26 |
|---|
| 2756 | + | pleas, pleas under chapter 552 or its successors, hearings, 27 |
|---|
| 2757 | + | sentencing and probation revocation hearings and the right 28 |
|---|
| 2758 | + | to be heard at such heari ngs, including juvenile 29 |
|---|
| 2759 | + | proceedings, unless in the determination of the court the 30 |
|---|
| 2760 | + | interests of justice require otherwise; 31 |
|---|
| 2761 | + | 83 |
|---|
| 2762 | + | (5) For victims, the right to be informed by local law 32 |
|---|
| 2763 | + | enforcement agencies, the appropriate juvenile authorities 33 |
|---|
| 2764 | + | or the custodial authority of the following: 34 |
|---|
| 2765 | + | (a) The status of any case concerning a crime against 35 |
|---|
| 2766 | + | the victim, including juvenile offenses; 36 |
|---|
| 2767 | + | (b) The right to be informed by local law enforcement 37 |
|---|
| 2768 | + | agencies or the appropriate juvenile authorities of the 38 |
|---|
| 2769 | + | availability of victim compensation assistance, assistance 39 |
|---|
| 2770 | + | in obtaining documentation of the victim's losses, 40 |
|---|
| 2771 | + | including, but not limited to and subject to existing law 41 |
|---|
| 2772 | + | concerning protected information or closed records, access 42 |
|---|
| 2773 | + | to copies of complete, una ltered, unedited investigation 43 |
|---|
| 2774 | + | reports of motor vehicle, pedestrian, and other similar 44 |
|---|
| 2775 | + | accidents upon request to the appropriate law enforcement 45 |
|---|
| 2776 | + | agency by the victim or the victim's representative, and 46 |
|---|
| 2777 | + | emergency crisis intervention services available i n the 47 |
|---|
| 2778 | + | community; 48 |
|---|
| 2779 | + | (c) Any release of such person on bond or for any 49 |
|---|
| 2780 | + | other reason; 50 |
|---|
| 2781 | + | (d) Within twenty-four hours, any escape by such 51 |
|---|
| 2782 | + | person from a municipal detention facility, county jail, a 52 |
|---|
| 2783 | + | correctional facility operated by the department of 53 |
|---|
| 2784 | + | corrections, mental health facility, or the division of 54 |
|---|
| 2785 | + | youth services or any agency thereof, and any subsequent 55 |
|---|
| 2786 | + | recapture of such person; and 56 |
|---|
| 2787 | + | (e) The name of an informant who has been endorsed 57 |
|---|
| 2788 | + | under section 491.065 as a witness by a prosecuting or 58 |
|---|
| 2789 | + | circuit attorney and any benefit that has been requested by 59 |
|---|
| 2790 | + | or has been offered to the informant and any benefit that 60 |
|---|
| 2791 | + | may be provided at a future date in connection with such 61 |
|---|
| 2792 | + | endorsement; 62 |
|---|
| 2793 | + | (6) For victims, the right to be informed by 63 |
|---|
| 2794 | + | appropriate juvenile authorities of probation revocation 64 |
|---|
| 2795 | + | 84 |
|---|
| 2796 | + | hearings initiated by the juvenile authority and the right 65 |
|---|
| 2797 | + | to be heard at such hearings or to offer a written 66 |
|---|
| 2798 | + | statement, video or audio tape, counsel or a representative 67 |
|---|
| 2799 | + | designated by the victim in lieu of a personal appearance, 68 |
|---|
| 2800 | + | the right to be informed by the board of probation and 69 |
|---|
| 2801 | + | parole of probation revocation hearings initiated by the 70 |
|---|
| 2802 | + | board and of parole hearings, the right to be present at 71 |
|---|
| 2803 | + | each and every phase of parole hearings, the right to be 72 |
|---|
| 2804 | + | heard at probation revocation and parole hearings or to 73 |
|---|
| 2805 | + | offer a written statement, video or audio tape, counsel or a 74 |
|---|
| 2806 | + | representative designated by the victim in lieu of a 75 |
|---|
| 2807 | + | personal appearance, and the right to have, upon written 76 |
|---|
| 2808 | + | request of the victim, a partition set up in the probation 77 |
|---|
| 2809 | + | or parole hearing room in such a way that the victim is 78 |
|---|
| 2810 | + | shielded from the view of the probationer or parolee, and 79 |
|---|
| 2811 | + | the right to be informed by the custodial mental health 80 |
|---|
| 2812 | + | facility or agency thereof of any hearings for the release 81 |
|---|
| 2813 | + | of a person committed pursuant to the provisions of chapter 82 |
|---|
| 2814 | + | 552, the right to be present at such hearings, the right to 83 |
|---|
| 2815 | + | be heard at such hearings or to offer a written statement, 84 |
|---|
| 2816 | + | video or audio tape, counsel or a representative designated 85 |
|---|
| 2817 | + | by the victim in lieu of personal appearance; 86 |
|---|
| 2818 | + | (7) For victims and witnesses, upon their written 87 |
|---|
| 2819 | + | request, the right to be informed by the appropriate 88 |
|---|
| 2820 | + | custodial authority, including any municipal detention 89 |
|---|
| 2821 | + | facility, juvenile detention facility, coun ty jail, 90 |
|---|
| 2822 | + | correctional facility operated by the department of 91 |
|---|
| 2823 | + | corrections, mental health facility, division of youth 92 |
|---|
| 2824 | + | services or agency thereof if the offense would have been a 93 |
|---|
| 2825 | + | felony if committed by an adult, postconviction or 94 |
|---|
| 2826 | + | commitment pursuant to t he provisions of chapter 552 of the 95 |
|---|
| 2827 | + | following: 96 |
|---|
| 2828 | + | 85 |
|---|
| 2829 | + | (a) The projected date of such person's release from 97 |
|---|
| 2830 | + | confinement; 98 |
|---|
| 2831 | + | (b) Any release of such person on bond; 99 |
|---|
| 2832 | + | (c) Any release of such person on furlough, work 100 |
|---|
| 2833 | + | release, trial release, electroni c monitoring program, or to 101 |
|---|
| 2834 | + | a community correctional facility or program or release for 102 |
|---|
| 2835 | + | any other reason, in advance of such release; 103 |
|---|
| 2836 | + | (d) Any scheduled parole or release hearings, 104 |
|---|
| 2837 | + | including hearings under section 217.362, regarding such 105 |
|---|
| 2838 | + | person and any changes in the scheduling of such hearings. 106 |
|---|
| 2839 | + | No such hearing shall be conducted without thirty days' 107 |
|---|
| 2840 | + | advance notice; 108 |
|---|
| 2841 | + | (e) Within twenty-four hours, any escape by such 109 |
|---|
| 2842 | + | person from a municipal detention facility, county jail, a 110 |
|---|
| 2843 | + | correctional facility operated by the department of 111 |
|---|
| 2844 | + | corrections, mental health facility, or the division of 112 |
|---|
| 2845 | + | youth services or any agency thereof, and any subsequent 113 |
|---|
| 2846 | + | recapture of such person; 114 |
|---|
| 2847 | + | (f) Any decision by a parole board, by a juvenile 115 |
|---|
| 2848 | + | releasing authority or by a circuit court presiding over 116 |
|---|
| 2849 | + | releases pursuant to the provisions of chapter 552, or by a 117 |
|---|
| 2850 | + | circuit court presiding over releases under section 217.362, 118 |
|---|
| 2851 | + | to release such person or any decision by the governor to 119 |
|---|
| 2852 | + | commute the sentence of such person or pardon such person; 120 |
|---|
| 2853 | + | and 121 |
|---|
| 2854 | + | (g) Notification within thirty days of the death of 122 |
|---|
| 2855 | + | such person; 123 |
|---|
| 2856 | + | (8) For witnesses who have been summoned by the 124 |
|---|
| 2857 | + | prosecuting attorney and for victims, to be notified by the 125 |
|---|
| 2858 | + | prosecuting attorney in a timely manner when a court 126 |
|---|
| 2859 | + | proceeding will not go on as scheduled; 127 |
|---|
| 2860 | + | (9) For victims and witnesses, the right to reasonable 128 |
|---|
| 2861 | + | protection from the defendant or any person acting on behalf 129 |
|---|
| 2862 | + | 86 |
|---|
| 2863 | + | of the defendant from harm and threats of harm arising out 130 |
|---|
| 2864 | + | of their cooperation with law enforcement and prosecution 131 |
|---|
| 2865 | + | efforts; 132 |
|---|
| 2866 | + | (10) For victims and witnesses, on charged cases or 133 |
|---|
| 2867 | + | submitted cases where no charge decision has yet been made, 134 |
|---|
| 2868 | + | to be informed by the prosecuting attorney of the status of 135 |
|---|
| 2869 | + | the case and of the avail ability of victim compensation 136 |
|---|
| 2870 | + | assistance and of financial assistance and emergency and 137 |
|---|
| 2871 | + | crisis intervention services available within the community 138 |
|---|
| 2872 | + | and information relative to applying for such assistance or 139 |
|---|
| 2873 | + | services, and of any final decision by the p rosecuting 140 |
|---|
| 2874 | + | attorney not to file charges; 141 |
|---|
| 2875 | + | (11) For victims, to be informed by the prosecuting 142 |
|---|
| 2876 | + | attorney of the right to restitution which shall be 143 |
|---|
| 2877 | + | enforceable in the same manner as any other cause of action 144 |
|---|
| 2878 | + | as otherwise provided by law; 145 |
|---|
| 2879 | + | (12) For victims and witnesses, to be informed by the 146 |
|---|
| 2880 | + | court and the prosecuting attorney of procedures to be 147 |
|---|
| 2881 | + | followed in order to apply for and receive any witness fee 148 |
|---|
| 2882 | + | to which they are entitled; 149 |
|---|
| 2883 | + | (13) When a victim's property is no longer needed for 150 |
|---|
| 2884 | + | evidentiary reasons or needs to be retained pending an 151 |
|---|
| 2885 | + | appeal, the prosecuting attorney or any law enforcement 152 |
|---|
| 2886 | + | agency having possession of the property shall, upon request 153 |
|---|
| 2887 | + | of the victim, return such property to the victim within 154 |
|---|
| 2888 | + | five working days unless the property is contraband or 155 |
|---|
| 2889 | + | subject to forfeiture proceedings, or provide written 156 |
|---|
| 2890 | + | explanation of the reason why such property shall not be 157 |
|---|
| 2891 | + | returned; 158 |
|---|
| 2892 | + | (14) An employer may not discharge or discipline any 159 |
|---|
| 2893 | + | witness, victim or member of a victim's i mmediate family for 160 |
|---|
| 2894 | + | honoring a subpoena to testify in a criminal proceeding, 161 |
|---|
| 2895 | + | attending a criminal proceeding, or for participating in the 162 |
|---|
| 2896 | + | 87 |
|---|
| 2897 | + | preparation of a criminal proceeding, or require any 163 |
|---|
| 2898 | + | witness, victim, or member of a victim's immediate family to 164 |
|---|
| 2899 | + | use vacation time, personal time, or sick leave for honoring 165 |
|---|
| 2900 | + | a subpoena to testify in a criminal proceeding, attending a 166 |
|---|
| 2901 | + | criminal proceeding, or participating in the preparation of 167 |
|---|
| 2902 | + | a criminal proceeding. A public school district, public 168 |
|---|
| 2903 | + | school, or charter school shall not discipline a child for 169 |
|---|
| 2904 | + | failure to comply with the district's or school's attendance 170 |
|---|
| 2905 | + | policy, and the parent or legal guardian shall not be deemed 171 |
|---|
| 2906 | + | to be in violation of the provisions of section 167.061, and 172 |
|---|
| 2907 | + | the district or school shall not otherwise discipline a 173 |
|---|
| 2908 | + | child, based on such child's honoring a subpoena to testify 174 |
|---|
| 2909 | + | in a criminal proceeding, attending a criminal proceeding, 175 |
|---|
| 2910 | + | or for participating in the preparation of a criminal 176 |
|---|
| 2911 | + | proceeding; 177 |
|---|
| 2912 | + | (15) For victims, to be prov ided with creditor 178 |
|---|
| 2913 | + | intercession services by the prosecuting attorney if the 179 |
|---|
| 2914 | + | victim is unable, as a result of the crime, temporarily to 180 |
|---|
| 2915 | + | meet financial obligations; 181 |
|---|
| 2916 | + | (16) For victims and witnesses, the right to speedy 182 |
|---|
| 2917 | + | disposition of their cases, and for victims, the right to 183 |
|---|
| 2918 | + | speedy appellate review of their cases, provided that 184 |
|---|
| 2919 | + | nothing in this subdivision shall prevent the defendant from 185 |
|---|
| 2920 | + | having sufficient time to prepare such defendant's defense. 186 |
|---|
| 2921 | + | The attorney general shall provide victims, upon their 187 |
|---|
| 2922 | + | written request, case status information throughout the 188 |
|---|
| 2923 | + | appellate process of their cases. The provisions of this 189 |
|---|
| 2924 | + | subdivision shall apply only to proceedings involving the 190 |
|---|
| 2925 | + | particular case to which the person is a victim or witness; 191 |
|---|
| 2926 | + | (17) For victims and witnesses, to be provided by the 192 |
|---|
| 2927 | + | court, a secure waiting area during court proceedings and to 193 |
|---|
| 2928 | + | receive notification of the date, time and location of any 194 |
|---|
| 2929 | + | hearing conducted by the court for reconsideration of any 195 |
|---|
| 2930 | + | 88 |
|---|
| 2931 | + | sentence imposed, modificati on of such sentence or recall 196 |
|---|
| 2932 | + | and release of any defendant from incarceration; and 197 |
|---|
| 2933 | + | (18) For victims, the right to receive upon request 198 |
|---|
| 2934 | + | from the department of corrections a photograph taken of the 199 |
|---|
| 2935 | + | defendant prior to release from incarceration. 200 |
|---|
| 2936 | + | 2. The provisions of subsection 1 of this section 201 |
|---|
| 2937 | + | shall not be construed to imply any victim who is 202 |
|---|
| 2938 | + | incarcerated by the department of corrections or any local 203 |
|---|
| 2939 | + | law enforcement agency has a right to be released to attend 204 |
|---|
| 2940 | + | any hearing or that the departm ent of corrections or the 205 |
|---|
| 2941 | + | local law enforcement agency has any duty to transport such 206 |
|---|
| 2942 | + | incarcerated victim to any hearing. 207 |
|---|
| 2943 | + | 3. Those persons entitled to notice of events pursuant 208 |
|---|
| 2944 | + | to the provisions of subsection 1 of this section shall 209 |
|---|
| 2945 | + | provide the appropriate person or agency with their current 210 |
|---|
| 2946 | + | addresses, electronic mail addresses, and telephone numbers 211 |
|---|
| 2947 | + | or the addresses, electronic mail addresses, or telephone 212 |
|---|
| 2948 | + | numbers at which they wish notification to be given. 213 |
|---|
| 2949 | + | 4. Notification by the approp riate person or agency 214 |
|---|
| 2950 | + | utilizing the statewide automated crime victim notification 215 |
|---|
| 2951 | + | system as established in section 650.310 shall constitute 216 |
|---|
| 2952 | + | compliance with the victim notification requirement of this 217 |
|---|
| 2953 | + | section. If notification utilizing the statewide a utomated 218 |
|---|
| 2954 | + | crime victim notification system cannot be used, then 219 |
|---|
| 2955 | + | written notification shall be sent by certified mail or 220 |
|---|
| 2956 | + | electronic mail to the most current address or electronic 221 |
|---|
| 2957 | + | mail address provided by the victim. 222 |
|---|
| 2958 | + | 5. Victims' rights as establishe d in Section 32 of 223 |
|---|
| 2959 | + | Article I of the Missouri Constitution or the laws of this 224 |
|---|
| 2960 | + | state pertaining to the rights of victims of crime shall be 225 |
|---|
| 2961 | + | granted and enforced regardless of the desires of a 226 |
|---|
| 2962 | + | defendant and no privileges of confidentiality shall exist 227 |
|---|
| 2963 | + | in favor of the defendant to exclude victims or prevent 228 |
|---|
| 2964 | + | 89 |
|---|
| 2965 | + | their full participation in each and every phase of parole 229 |
|---|
| 2966 | + | hearings or probation revocation hearings. The rights of 230 |
|---|
| 2967 | + | the victims granted in this section are absolute and the 231 |
|---|
| 2968 | + | policy of this state is that the victim's rights are 232 |
|---|
| 2969 | + | paramount to the defendant's rights. The victim has an 233 |
|---|
| 2970 | + | absolute right to be present at any hearing in which the 234 |
|---|
| 2971 | + | defendant is present before a probation and parole hearing 235 |
|---|
| 2972 | + | officer. 236 |
|---|
| 2973 | + | 595.325. 1. There is hereby created the "Missing and 1 |
|---|
| 2974 | + | Murdered African American Women and Girls Task Force" to 2 |
|---|
| 2975 | + | consist of the following members: 3 |
|---|
| 2976 | + | (1) The following four members of the general assembly: 4 |
|---|
| 2977 | + | (a) Two members of the senate, with one member to be 5 |
|---|
| 2978 | + | appointed by the president pro tempore of the senate and one 6 |
|---|
| 2979 | + | member to be appointed by the minority floor leader of the 7 |
|---|
| 2980 | + | senate; and 8 |
|---|
| 2981 | + | (b) Two members of the house of representatives, with 9 |
|---|
| 2982 | + | one member to be appointed by the speaker of the house of 10 |
|---|
| 2983 | + | representatives and one member to be appointed by the 11 |
|---|
| 2984 | + | minority floor leader of the house of representatives; 12 |
|---|
| 2985 | + | (2) The director of the department of public safety or 13 |
|---|
| 2986 | + | his or her designee; 14 |
|---|
| 2987 | + | (3) Two representatives appointed by the director of 15 |
|---|
| 2988 | + | the department of public safety from among the following: 16 |
|---|
| 2989 | + | (a) A member from the Missouri Police Chiefs 17 |
|---|
| 2990 | + | Association; 18 |
|---|
| 2991 | + | (b) A member from the Missouri Sheriffs Association; or 19 |
|---|
| 2992 | + | (c) The superintendent of the Missouri highway patrol 20 |
|---|
| 2993 | + | or his or her designee ; 21 |
|---|
| 2994 | + | (4) One or more representatives appointed by the 22 |
|---|
| 2995 | + | director of public safety from among the following: 23 |
|---|
| 2996 | + | (a) The attorney general or his or her designee; 24 |
|---|
| 2997 | + | 90 |
|---|
| 2998 | + | (b) The director of the Missouri office of prosecution 25 |
|---|
| 2999 | + | services; 26 |
|---|
| 3000 | + | (c) The president of the Missouri prosecutors 27 |
|---|
| 3001 | + | association; 28 |
|---|
| 3002 | + | (d) A judge or attorney working in a juvenile court; or 29 |
|---|
| 3003 | + | (e) An attorney working in the United States 30 |
|---|
| 3004 | + | Attorney's Office; 31 |
|---|
| 3005 | + | (5) A county coroner or a representative from a 32 |
|---|
| 3006 | + | statewide coroner's a ssociation; 33 |
|---|
| 3007 | + | (6) Three or more representatives appointed by the 34 |
|---|
| 3008 | + | director of public safety from among the following: 35 |
|---|
| 3009 | + | (a) A statewide or local organization that provides 36 |
|---|
| 3010 | + | legal services to African American women and girls; 37 |
|---|
| 3011 | + | (b) A statewide or local organization that provides 38 |
|---|
| 3012 | + | advocacy or counseling for African American women and girls 39 |
|---|
| 3013 | + | who have been victims of violence; 40 |
|---|
| 3014 | + | (c) A statewide or local organization that provides 41 |
|---|
| 3015 | + | services to African American women and girls; or 42 |
|---|
| 3016 | + | (d) An African American woman who is a survivor of 43 |
|---|
| 3017 | + | gender violence. 44 |
|---|
| 3018 | + | 2. The task force shall appoint a chairperson who is 45 |
|---|
| 3019 | + | elected by a majority vote of the members of the task 46 |
|---|
| 3020 | + | force. The task force shall have an initial meeting before 47 |
|---|
| 3021 | + | October 1, 2025. The members of the task force shall serve 48 |
|---|
| 3022 | + | without compensation, but shall be entitled to necessary and 49 |
|---|
| 3023 | + | actual expenses incurred in attending meetings of the task 50 |
|---|
| 3024 | + | force. 51 |
|---|
| 3025 | + | 3. The task force shall examine and report on the 52 |
|---|
| 3026 | + | following: 53 |
|---|
| 3027 | + | (1) The systemic causes behind violence that African 54 |
|---|
| 3028 | + | American women and girls experience, including patterns and 55 |
|---|
| 3029 | + | underlying factors that explain why disproportionately high 56 |
|---|
| 3030 | + | levels of violence occur against African American women and 57 |
|---|
| 3031 | + | 91 |
|---|
| 3032 | + | girls, including underlying hist orical, social, economic, 58 |
|---|
| 3033 | + | institutional, and cultural factors that may contribute to 59 |
|---|
| 3034 | + | the violence; 60 |
|---|
| 3035 | + | (2) Appropriate methods for tracking and collecting 61 |
|---|
| 3036 | + | data on violence against African American women and girls, 62 |
|---|
| 3037 | + | including data on missing and murder ed African American 63 |
|---|
| 3038 | + | women and girls; 64 |
|---|
| 3039 | + | (3) Policies and institutions such as policing, child 65 |
|---|
| 3040 | + | welfare, coroner practices, and other governmental practices 66 |
|---|
| 3041 | + | that impact violence against African American women and 67 |
|---|
| 3042 | + | girls and the investigation and prosec ution of crimes of 68 |
|---|
| 3043 | + | gender violence against African American women and girls; 69 |
|---|
| 3044 | + | (4) Measures necessary to address and reduce violence 70 |
|---|
| 3045 | + | against African American women and girls; and 71 |
|---|
| 3046 | + | (5) Measures to help victims, victims' families, and 72 |
|---|
| 3047 | + | victims' communities prevent and heal from violence that 73 |
|---|
| 3048 | + | occurs against African American women and girls. 74 |
|---|
| 3049 | + | 4. The department of public safety shall provide 75 |
|---|
| 3050 | + | administrative support to the task force. 76 |
|---|
| 3051 | + | 5. On or before December thirty -first of each year, 77 |
|---|
| 3052 | + | the task force shall submit a report on its findings to the 78 |
|---|
| 3053 | + | governor and the general assembly. 79 |
|---|
| 3054 | + | 6. The task force shall expire on December 31, 2027, 80 |
|---|
| 3055 | + | unless extended until December 31, 2029, as determined 81 |
|---|
| 3056 | + | necessary by the department of public safety. 82 |
|---|
| 3057 | + | 650.058. 1. Notwithstanding the sovereign immunity of 1 |
|---|
| 3058 | + | the state, any individual who was found guilty of a felony 2 |
|---|
| 3059 | + | in a Missouri court and was later determined to be actually 3 |
|---|
| 3060 | + | innocent of such crime [solely as a result of DNA profil ing 4 |
|---|
| 3061 | + | analysis] may be paid restitution. The individual may 5 |
|---|
| 3062 | + | receive an amount of one hundred seventy-nine dollars per 6 |
|---|
| 3063 | + | day for each day of postconviction incarceration for the 7 |
|---|
| 3064 | + | crime for which the individual is determined to be actually 8 |
|---|
| 3065 | + | 92 |
|---|
| 3066 | + | innocent. The petition for the payment of said restitution 9 |
|---|
| 3067 | + | shall be filed with the sentencing court. For the purposes 10 |
|---|
| 3068 | + | of this section, the term "actually innocent" shall mean: 11 |
|---|
| 3069 | + | (1) The individual was convicted of a felony for which 12 |
|---|
| 3070 | + | a final order of release was en tered by the court; 13 |
|---|
| 3071 | + | (2) All appeals of the order of release have been 14 |
|---|
| 3072 | + | exhausted; 15 |
|---|
| 3073 | + | (3) The individual was not serving any term of a 16 |
|---|
| 3074 | + | sentence for any other crime concurrently with the sentence 17 |
|---|
| 3075 | + | for which he or she is determined to be actually in nocent, 18 |
|---|
| 3076 | + | unless such individual was serving another concurrent 19 |
|---|
| 3077 | + | sentence because his or her parole was revoked by a court or 20 |
|---|
| 3078 | + | the parole board in connection with the crime for which the 21 |
|---|
| 3079 | + | person has been exonerated. Regardless of whether any other 22 |
|---|
| 3080 | + | basis may exist for the revocation of the person's probation 23 |
|---|
| 3081 | + | or parole at the time of conviction for the crime for which 24 |
|---|
| 3082 | + | the person is later determined to be actually innocent, when 25 |
|---|
| 3083 | + | the court's or the parole board's sole stated reason for the 26 |
|---|
| 3084 | + | revocation in its order is the conviction for the crime for 27 |
|---|
| 3085 | + | which the person is later determined to be actually 28 |
|---|
| 3086 | + | innocent, such order shall, for purposes of this section 29 |
|---|
| 3087 | + | only, be conclusive evidence that [their] the persons's 30 |
|---|
| 3088 | + | probation or parole was revoked in connecti on with the crime 31 |
|---|
| 3089 | + | for which the person has been exonerated; and 32 |
|---|
| 3090 | + | (4) Testing ordered under section 547.035, or testing 33 |
|---|
| 3091 | + | by the order of any state or federal court, if such person 34 |
|---|
| 3092 | + | was exonerated on or before August 28, 2004, or testing 35 |
|---|
| 3093 | + | ordered under section 650.055, if such person was or is 36 |
|---|
| 3094 | + | exonerated after August 28, 2004, or after an evidentiary 37 |
|---|
| 3095 | + | hearing and finding in a habeas corpus proceeding or a 38 |
|---|
| 3096 | + | proceeding held pursuant to section 547.031 which 39 |
|---|
| 3097 | + | demonstrates a person's innocence of the crime for which the 40 |
|---|
| 3098 | + | person is in custody. 41 |
|---|
| 3099 | + | 93 |
|---|
| 3100 | + | Any individual who receives restitution under this section 42 |
|---|
| 3101 | + | shall be prohibited from seeking any civil redress from the 43 |
|---|
| 3102 | + | state, its departments and agencies, or any employee 44 |
|---|
| 3103 | + | thereof, or any political subdivision or it s employees. 45 |
|---|
| 3104 | + | This section shall not be construed as a waiver of sovereign 46 |
|---|
| 3105 | + | immunity for any purposes other than the restitution 47 |
|---|
| 3106 | + | provided for herein. The department of corrections shall 48 |
|---|
| 3107 | + | determine the aggregate amount of restitution owed during a 49 |
|---|
| 3108 | + | fiscal year. If insufficient moneys are appropriated each 50 |
|---|
| 3109 | + | fiscal year to pay restitution to such persons, the 51 |
|---|
| 3110 | + | department shall pay each individual who has received an 52 |
|---|
| 3111 | + | order awarding restitution a pro rata share of the amount 53 |
|---|
| 3112 | + | appropriated. Provided sufficient moneys are appropriated 54 |
|---|
| 3113 | + | to the department, the amounts owed to such individual shall 55 |
|---|
| 3114 | + | be paid on June thirtieth of each subsequent fiscal year, 56 |
|---|
| 3115 | + | until such time as the restitution to the individual has 57 |
|---|
| 3116 | + | been paid in full. However, no individual award ed 58 |
|---|
| 3117 | + | restitution under this subsection shall receive more than 59 |
|---|
| 3118 | + | [thirty-six] sixty-five thousand [five hundred] dollars 60 |
|---|
| 3119 | + | during each fiscal year. No interest on unpaid restitution 61 |
|---|
| 3120 | + | shall be awarded to the individual. [No individual who has 62 |
|---|
| 3121 | + | been determined by the court to be actually innocent shall 63 |
|---|
| 3122 | + | be responsible for the costs of care under section 217.831 ] 64 |
|---|
| 3123 | + | However, an individual may also be awarded other nonmonetary 65 |
|---|
| 3124 | + | relief, including counseling, housing assistance, and 66 |
|---|
| 3125 | + | personal financial literary assi stance. 67 |
|---|
| 3126 | + | 2. If the results of the DNA testing confirm the 68 |
|---|
| 3127 | + | person's guilt, then the person filing for DNA testing under 69 |
|---|
| 3128 | + | section 547.035, shall: 70 |
|---|
| 3129 | + | (1) Be liable for any reasonable costs incurred when 71 |
|---|
| 3130 | + | conducting the DNA test, including but not lim ited to the 72 |
|---|
| 3131 | + | cost of the test. Such costs shall be determined by the 73 |
|---|
| 3132 | + | 94 |
|---|
| 3133 | + | court and shall be included in the findings of fact and 74 |
|---|
| 3134 | + | conclusions of law made by the court; and 75 |
|---|
| 3135 | + | (2) Be sanctioned under the provisions of section 76 |
|---|
| 3136 | + | 217.262. 77 |
|---|
| 3137 | + | 3. A petition for payment of restitution under this 78 |
|---|
| 3138 | + | section may [only] be filed only by the individual 79 |
|---|
| 3139 | + | determined to be actually innocent or the individual's legal 80 |
|---|
| 3140 | + | guardian. No claim or petition for restitution under this 81 |
|---|
| 3141 | + | section may be filed by the individual's he irs or assigns. 82 |
|---|
| 3142 | + | An individual's right to receive restitution under this 83 |
|---|
| 3143 | + | section is not assignable or otherwise transferrable. The 84 |
|---|
| 3144 | + | state's obligation to pay restitution under this section 85 |
|---|
| 3145 | + | shall cease upon the individual's death. Any beneficiary 86 |
|---|
| 3146 | + | designation that purports to bequeath, assign, or otherwise 87 |
|---|
| 3147 | + | convey the right to receive such restitution shall be void 88 |
|---|
| 3148 | + | and unenforceable. 89 |
|---|
| 3149 | + | 4. An individual who is determined to be actually 90 |
|---|
| 3150 | + | innocent of a crime under this chapter shall automatically 91 |
|---|
| 3151 | + | be granted an order of expungement from the court in which 92 |
|---|
| 3152 | + | he or she pled guilty or was sentenced to expunge from all 93 |
|---|
| 3153 | + | official records all recordations of his or her arrest, 94 |
|---|
| 3154 | + | plea, trial or conviction. Upon the court's granting of the 95 |
|---|
| 3155 | + | order of expungement , the records and files maintained in 96 |
|---|
| 3156 | + | any administrative or court proceeding in an associate or 97 |
|---|
| 3157 | + | circuit division of the court shall be confidential and 98 |
|---|
| 3158 | + | [only] available only to the parties or by order of the 99 |
|---|
| 3159 | + | court for good cause shown. The effect of such order shall 100 |
|---|
| 3160 | + | be to restore such person to the status he or she occupied 101 |
|---|
| 3161 | + | prior to such arrest, plea or conviction and as if such 102 |
|---|
| 3162 | + | event had never taken place. No person as to whom such 103 |
|---|
| 3163 | + | order has been entered shall be held thereafter under any 104 |
|---|
| 3164 | + | provision of any law to be guilty of perjury or otherwise 105 |
|---|
| 3165 | + | giving a false statement by reason of his or her failure to 106 |
|---|
| 3166 | + | 95 |
|---|
| 3167 | + | recite or acknowledge such arrest, plea, trial, conviction 107 |
|---|
| 3168 | + | or expungement in response to any inquiry made of him or her 108 |
|---|
| 3169 | + | for any purpose what soever and no such inquiry shall be made 109 |
|---|
| 3170 | + | for information relating to an expungement under this 110 |
|---|
| 3171 | + | section. 111 |
|---|
| 3172 | + | Section 1. In the event that any section, provision, 1 |
|---|
| 3173 | + | clause, phrase, or word of this act or the application 2 |
|---|
| 3174 | + | thereof is declared invalid under the Constitution of the 3 |
|---|
| 3175 | + | United States or the Constitution of the State of Missouri, 4 |
|---|
| 3176 | + | it is the intent of the general assembly that the remaining 5 |
|---|
| 3177 | + | sections of this act remain in force and effect as far as 6 |
|---|
| 3178 | + | they are capable of being carried into execution as intended 7 |
|---|
| 3179 | + | by the general assembly. The general assembly hereby 8 |
|---|
| 3180 | + | declares that it would have passed each section, provision, 9 |
|---|
| 3181 | + | clause, phrase, or word thereof, irrespective of the fact 10 |
|---|
| 3182 | + | that any one or more sections, provisions, clauses, p hrases, 11 |
|---|
| 3183 | + | or words of this act or the application of this act would be 12 |
|---|
| 3184 | + | declared unenforceable, unconstitutional, or invalid. 13 |
|---|
| 3185 | + | [84.175. 1. Upon recommendation of the 1 |
|---|
| 3186 | + | chief of police, the board may authorize and 2 |
|---|
| 3187 | + | provide for the organi zation of a police reserve 3 |
|---|
| 3188 | + | force composed of members who receive a service 4 |
|---|
| 3189 | + | retirement under the provisions of sections 5 |
|---|
| 3190 | + | 86.200 to 86.366 and who qualify under the 6 |
|---|
| 3191 | + | provisions of section 84.120. Such reserve 7 |
|---|
| 3192 | + | force shall be under the command of the chief of 8 |
|---|
| 3193 | + | police and shall be provided training, 9 |
|---|
| 3194 | + | equipment, uniforms, and arms as the chief shall 10 |
|---|
| 3195 | + | direct with the approval of the board. Members 11 |
|---|
| 3196 | + | of the reserve force shall possess all of the 12 |
|---|
| 3197 | + | powers of regular police officers and shall be 13 |
|---|
| 3198 | + | subject to all laws and regulations applicable 14 |
|---|
| 3199 | + | to police officers; provided, however, that the 15 |
|---|
| 3200 | + | city council or other governing body of any such 16 |
|---|
| 3201 | + | city may in its discretion fix a total in number 17 |
|---|
| 3202 | + | which the reserve force may not exceed. 18 |
|---|
| 3203 | + | 2. In event of riot or other e mergencies 19 |
|---|
| 3204 | + | as declared and defined by the mayor, in 20 |
|---|
| 3205 | + | concurrence with the board, the board, upon 21 |
|---|
| 3206 | + | 96 |
|---|
| 3207 | + | recommendation of the chief, may appoint special 22 |
|---|
| 3208 | + | officers or patrolmen for temporary service in 23 |
|---|
| 3209 | + | addition to the police reserve force herein 24 |
|---|
| 3210 | + | provided for, but the length of time for which 25 |
|---|
| 3211 | + | such officers or patrolmen shall be employed 26 |
|---|
| 3212 | + | shall be limited to the time during which such 27 |
|---|
| 3213 | + | emergency shall exist. ] 28 |
|---|
| 3214 | + | [84.240. The board of police commissioners 1 |
|---|
| 3215 | + | shall establish the Bertillon system o f 2 |
|---|
| 3216 | + | identification of criminals and others by means 3 |
|---|
| 3217 | + | of anthropometric indications, and they are 4 |
|---|
| 3218 | + | further required to employ such additional 5 |
|---|
| 3219 | + | assistance as may be necessary to properly 6 |
|---|
| 3220 | + | conduct and manage this department. ] 7 |
|---|
| 3221 | + | [84.341. No elected or appointed official 1 |
|---|
| 3222 | + | of the state or any political subdivision 2 |
|---|
| 3223 | + | thereof shall act or refrain from acting in any 3 |
|---|
| 3224 | + | manner to impede, obstruct, hinder, or otherwise 4 |
|---|
| 3225 | + | interfere with any member of a municipal police 5 |
|---|
| 3226 | + | force established under sections 8 4.343 to 6 |
|---|
| 3227 | + | 84.346 in the performance of his or her job 7 |
|---|
| 3228 | + | duties, or with any aspect of any investigation 8 |
|---|
| 3229 | + | arising from the performance of such job 9 |
|---|
| 3230 | + | duties. This section shall not be construed to 10 |
|---|
| 3231 | + | prevent such officials from acting within the 11 |
|---|
| 3232 | + | normal course and scope of their employment or 12 |
|---|
| 3233 | + | from acting to implement sections 84.343 to 13 |
|---|
| 3234 | + | 84.346. Any person who violates this section 14 |
|---|
| 3235 | + | shall be liable for a penalty of two thousand 15 |
|---|
| 3236 | + | five hundred dollars for each offense and shall 16 |
|---|
| 3237 | + | forever be disqualified from holdi ng any office 17 |
|---|
| 3238 | + | or employment whatsoever with the governmental 18 |
|---|
| 3239 | + | entity the person served at the time of the 19 |
|---|
| 3240 | + | violation. The penalty shall not be paid by the 20 |
|---|
| 3241 | + | funds of any committee as the term committee is 21 |
|---|
| 3242 | + | defined in section 130.011. This section shall 22 |
|---|
| 3243 | + | not be construed to interfere with the 23 |
|---|
| 3244 | + | punishment, under any laws of this state, of a 24 |
|---|
| 3245 | + | criminal offense committed by such officials, 25 |
|---|
| 3246 | + | nor shall this section apply to duly appointed 26 |
|---|
| 3247 | + | members of the municipal police force, or their 27 |
|---|
| 3248 | + | appointing authorities, whose conduct is 28 |
|---|
| 3249 | + | otherwise provided for by law. ] 29 |
|---|
| 3250 | + | 97 |
|---|
| 3251 | + | [84.342. 1. It shall be an unlawful 1 |
|---|
| 3252 | + | employment practice for an official, employee, 2 |
|---|
| 3253 | + | or agent of a municipal police force established 3 |
|---|
| 3254 | + | under sections 84.343 to 84.346 to discharge, 4 |
|---|
| 3255 | + | demote, reduce the pay of, or otherwise 5 |
|---|
| 3256 | + | retaliate against an employee of the municipal 6 |
|---|
| 3257 | + | police force for reporting to any superior, 7 |
|---|
| 3258 | + | government agency, or the press the conduct of 8 |
|---|
| 3259 | + | another employee that the reporting employee 9 |
|---|
| 3260 | + | believes, in good faith, is i llegal. 10 |
|---|
| 3261 | + | 2. Any employee of the municipal police 11 |
|---|
| 3262 | + | force may bring a cause of action for general or 12 |
|---|
| 3263 | + | special damages based on a violation of this 13 |
|---|
| 3264 | + | section.] 14 |
|---|
| 3265 | + | [84.343. 1. Subject to the provisions of 1 |
|---|
| 3266 | + | sections 84.344 to 84.346, any city not within a 2 |
|---|
| 3267 | + | county may establish a municipal police force 3 |
|---|
| 3268 | + | for the purposes of: 4 |
|---|
| 3269 | + | (1) Preserving the public peace, welfare, 5 |
|---|
| 3270 | + | and order; 6 |
|---|
| 3271 | + | (2) Preventing crime and arresting 7 |
|---|
| 3272 | + | suspected offenders; 8 |
|---|
| 3273 | + | (3) Enforcing the laws of the state and 9 |
|---|
| 3274 | + | ordinances of the city; 10 |
|---|
| 3275 | + | (4) Exercising all powers available to a 11 |
|---|
| 3276 | + | police force under generally applicable state 12 |
|---|
| 3277 | + | law; and 13 |
|---|
| 3278 | + | (5) Regulating and licensing all private 14 |
|---|
| 3279 | + | watchmen, private detectives, and private 15 |
|---|
| 3280 | + | policemen serving or acting as such in said city. 16 |
|---|
| 3281 | + | 2. Any person who acts as a private 17 |
|---|
| 3282 | + | watchman, private detective, or private 18 |
|---|
| 3283 | + | policeman in said cities without having obtained 19 |
|---|
| 3284 | + | a written license from said cities is guilty of 20 |
|---|
| 3285 | + | a class A misdemeanor. ] 21 |
|---|
| 3286 | + | [84.344. 1. Notwithstanding any 1 |
|---|
| 3287 | + | provisions of this chapter to the contrary, any 2 |
|---|
| 3288 | + | city not within a county may establish a 3 |
|---|
| 3289 | + | municipal police force on or after July 1, 2013, 4 |
|---|
| 3290 | + | according to the procedures and requirements of 5 |
|---|
| 3291 | + | this section. The purpose of these procedur es 6 |
|---|
| 3292 | + | and requirements is to provide for an orderly 7 |
|---|
| 3293 | + | and appropriate transition in the governance of 8 |
|---|
| 3294 | + | the police force and provide for an equitable 9 |
|---|
| 3295 | + | 98 |
|---|
| 3296 | + | employment transition for commissioned and 10 |
|---|
| 3297 | + | civilian personnel. 11 |
|---|
| 3298 | + | 2. Upon the establishment of a municipa l 12 |
|---|
| 3299 | + | police force by a city under sections 84.343 to 13 |
|---|
| 3300 | + | 84.346, the board of police commissioners shall 14 |
|---|
| 3301 | + | convey, assign, and otherwise transfer to the 15 |
|---|
| 3302 | + | city title and ownership of all indebtedness and 16 |
|---|
| 3303 | + | assets, including, but not limited to, all funds 17 |
|---|
| 3304 | + | and real and personal property held in the name 18 |
|---|
| 3305 | + | of or controlled by the board of police 19 |
|---|
| 3306 | + | commissioners created under sections 84.010 to 20 |
|---|
| 3307 | + | 84.340. The board of police commissioners shall 21 |
|---|
| 3308 | + | execute all documents reasonably required to 22 |
|---|
| 3309 | + | accomplish such transfer of ow nership and 23 |
|---|
| 3310 | + | obligations. 24 |
|---|
| 3311 | + | 3. If the city establishes a municipal 25 |
|---|
| 3312 | + | police force and completes the transfer 26 |
|---|
| 3313 | + | described in subsection 2 of this section, the 27 |
|---|
| 3314 | + | city shall provide the necessary funds for the 28 |
|---|
| 3315 | + | maintenance of the municipal police force. 29 |
|---|
| 3316 | + | 4. Before a city not within a county may 30 |
|---|
| 3317 | + | establish a municipal police force under this 31 |
|---|
| 3318 | + | section, the city shall adopt an ordinance 32 |
|---|
| 3319 | + | accepting responsibility, ownership, and 33 |
|---|
| 3320 | + | liability as successor -in-interest for 34 |
|---|
| 3321 | + | contractual obligations, indebtedness, and other 35 |
|---|
| 3322 | + | lawful obligations of the board of police 36 |
|---|
| 3323 | + | commissioners subject to the provisions of 37 |
|---|
| 3324 | + | subsection 2 of section 84.345. 38 |
|---|
| 3325 | + | 5. A city not within a county that 39 |
|---|
| 3326 | + | establishes a municipal police force shall 40 |
|---|
| 3327 | + | initially employ, without a reduction in rank, 41 |
|---|
| 3328 | + | salary, or benefits, all commissioned and 42 |
|---|
| 3329 | + | civilian personnel of the board of police 43 |
|---|
| 3330 | + | commissioners created under sections 84.010 to 44 |
|---|
| 3331 | + | 84.340 that were employed by the board 45 |
|---|
| 3332 | + | immediately prior to the date the municipal 46 |
|---|
| 3333 | + | police force was established. Such commissioned 47 |
|---|
| 3334 | + | personnel who previously were employed by the 48 |
|---|
| 3335 | + | board may only be involuntarily terminated by 49 |
|---|
| 3336 | + | the city not within a county for cause. The 50 |
|---|
| 3337 | + | city shall also recognize all accrued years of 51 |
|---|
| 3338 | + | service that such commissioned and civilian 52 |
|---|
| 3339 | + | personnel had with the board of police 53 |
|---|
| 3340 | + | commissioners. Such personnel shall be entitled 54 |
|---|
| 3341 | + | to the same holidays, vacation, and sick leave 55 |
|---|
| 3342 | + | 99 |
|---|
| 3343 | + | they were entitled to as employees of the board 56 |
|---|
| 3344 | + | of police commissioners. 57 |
|---|
| 3345 | + | 6. Commissioned and civilian personnel o f 58 |
|---|
| 3346 | + | a municipal police force established under this 59 |
|---|
| 3347 | + | section shall not be subject to a residency 60 |
|---|
| 3348 | + | requirement of retaining a primary residence in 61 |
|---|
| 3349 | + | a city not within a county but may be required 62 |
|---|
| 3350 | + | to maintain a primary residence located within a 63 |
|---|
| 3351 | + | one-hour response time. 64 |
|---|
| 3352 | + | 7. The commissioned and civilian personnel 65 |
|---|
| 3353 | + | who retire from service with the board of police 66 |
|---|
| 3354 | + | commissioners before the establishment of a 67 |
|---|
| 3355 | + | municipal police force under subsection 1 of 68 |
|---|
| 3356 | + | this section shall continue to be entitled to 69 |
|---|
| 3357 | + | the same pension benefits provided under chapter 70 |
|---|
| 3358 | + | 86 and the same benefits set forth in subsection 71 |
|---|
| 3359 | + | 5 of this section. 72 |
|---|
| 3360 | + | 8. If the city not within a county elects 73 |
|---|
| 3361 | + | to establish a municipal police force under this 74 |
|---|
| 3362 | + | section, the city shall establish a separate 75 |
|---|
| 3363 | + | division for the operation of its municipal 76 |
|---|
| 3364 | + | police force. The civil service commission of 77 |
|---|
| 3365 | + | the city may adopt rules and regulations 78 |
|---|
| 3366 | + | appropriate for the unique operation of a police 79 |
|---|
| 3367 | + | department. Such rules and regulations shall 80 |
|---|
| 3368 | + | reserve exclusive auth ority over the 81 |
|---|
| 3369 | + | disciplinary process and procedures affecting 82 |
|---|
| 3370 | + | commissioned officers to the civil service 83 |
|---|
| 3371 | + | commission; however, until such time as the city 84 |
|---|
| 3372 | + | adopts such rules and regulations, the 85 |
|---|
| 3373 | + | commissioned personnel shall continue to be 86 |
|---|
| 3374 | + | governed by the board of police commissioner's 87 |
|---|
| 3375 | + | rules and regulations in effect immediately 88 |
|---|
| 3376 | + | prior to the establishment of the municipal 89 |
|---|
| 3377 | + | police force, with the police chief acting in 90 |
|---|
| 3378 | + | place of the board of police commissioners for 91 |
|---|
| 3379 | + | purposes of applying the rules and re gulations. 92 |
|---|
| 3380 | + | Unless otherwise provided for, existing civil 93 |
|---|
| 3381 | + | service commission rules and regulations 94 |
|---|
| 3382 | + | governing the appeal of disciplinary decisions 95 |
|---|
| 3383 | + | to the civil service commission shall apply to 96 |
|---|
| 3384 | + | all commissioned and civilian personnel. The 97 |
|---|
| 3385 | + | civil service commission's rules and regulations 98 |
|---|
| 3386 | + | shall provide that records prepared for 99 |
|---|
| 3387 | + | disciplinary purposes shall be confidential, 100 |
|---|
| 3388 | + | closed records available solely to the civil 101 |
|---|
| 3389 | + | 100 |
|---|
| 3390 | + | service commission and those who possess 102 |
|---|
| 3391 | + | authority to conduct investigations regard ing 103 |
|---|
| 3392 | + | disciplinary matters pursuant to the civil 104 |
|---|
| 3393 | + | service commission's rules and regulations. A 105 |
|---|
| 3394 | + | hearing officer shall be appointed by the civil 106 |
|---|
| 3395 | + | service commission to hear any such appeals that 107 |
|---|
| 3396 | + | involve discipline resulting in a suspension of 108 |
|---|
| 3397 | + | greater than fifteen days, demotion, or 109 |
|---|
| 3398 | + | termination, but the civil service commission 110 |
|---|
| 3399 | + | shall make the final findings of fact, 111 |
|---|
| 3400 | + | conclusions of law, and decision which shall be 112 |
|---|
| 3401 | + | subject to any right of appeal under chapter 536. 113 |
|---|
| 3402 | + | 9. A city not within a county that 114 |
|---|
| 3403 | + | establishes and maintains a municipal police 115 |
|---|
| 3404 | + | force under this section: 116 |
|---|
| 3405 | + | (1) Shall provide or contract for life 117 |
|---|
| 3406 | + | insurance coverage and for insurance benefits 118 |
|---|
| 3407 | + | providing health, medical, and disability 119 |
|---|
| 3408 | + | coverage for commissioned and civilian personn el 120 |
|---|
| 3409 | + | of the municipal police force to the same extent 121 |
|---|
| 3410 | + | as was provided by the board of police 122 |
|---|
| 3411 | + | commissioners under section 84.160; 123 |
|---|
| 3412 | + | (2) Shall provide or contract for medical 124 |
|---|
| 3413 | + | and life insurance coverage for any commissioned 125 |
|---|
| 3414 | + | or civilian personnel who r etired from service 126 |
|---|
| 3415 | + | with the board of police commissioners or who 127 |
|---|
| 3416 | + | were employed by the board of police 128 |
|---|
| 3417 | + | commissioners and retire from the municipal 129 |
|---|
| 3418 | + | police force of a city not within a county to 130 |
|---|
| 3419 | + | the same extent such medical and life insurance 131 |
|---|
| 3420 | + | coverage was provided by the board of police 132 |
|---|
| 3421 | + | commissioners under section 84.160; 133 |
|---|
| 3422 | + | (3) Shall make available medical and life 134 |
|---|
| 3423 | + | insurance coverage for purchase to the spouses 135 |
|---|
| 3424 | + | or dependents of commissioned and civilian 136 |
|---|
| 3425 | + | personnel who retire from service with the board 137 |
|---|
| 3426 | + | of police commissioners or the municipal police 138 |
|---|
| 3427 | + | force and deceased commissioned and civilian 139 |
|---|
| 3428 | + | personnel who receive pension benefits under 140 |
|---|
| 3429 | + | sections 86.200 to 86.366 at the rate that such 141 |
|---|
| 3430 | + | dependent's or spouse's coverage would cost 142 |
|---|
| 3431 | + | under the appropriate plan if the deceased were 143 |
|---|
| 3432 | + | living; and 144 |
|---|
| 3433 | + | (4) May pay an additional shift 145 |
|---|
| 3434 | + | differential compensation to commissioned and 146 |
|---|
| 3435 | + | civilian personnel for evening and night tours 147 |
|---|
| 3436 | + | 101 |
|---|
| 3437 | + | of duty in an amount not to exceed ten percent 148 |
|---|
| 3438 | + | of the officer's base hour ly rate. 149 |
|---|
| 3439 | + | 10. A city not within a county that 150 |
|---|
| 3440 | + | establishes a municipal police force under 151 |
|---|
| 3441 | + | sections 84.343 to 84.346 shall establish a 152 |
|---|
| 3442 | + | transition committee of five members for the 153 |
|---|
| 3443 | + | purpose of: coordinating and implementing the 154 |
|---|
| 3444 | + | transition of authori ty, operations, assets, and 155 |
|---|
| 3445 | + | obligations from the board of police 156 |
|---|
| 3446 | + | commissioners to the city; winding down the 157 |
|---|
| 3447 | + | affairs of the board; making nonbinding 158 |
|---|
| 3448 | + | recommendations for the transition of the police 159 |
|---|
| 3449 | + | force from the board to the city; and other 160 |
|---|
| 3450 | + | related duties, if any, established by executive 161 |
|---|
| 3451 | + | order of the city's mayor. Once the ordinance 162 |
|---|
| 3452 | + | referenced in this section is enacted, the city 163 |
|---|
| 3453 | + | shall provide written notice to the board of 164 |
|---|
| 3454 | + | police commissioners and the governor of the 165 |
|---|
| 3455 | + | state of Missouri. Within thirty days of such 166 |
|---|
| 3456 | + | notice, the mayor shall appoint three members to 167 |
|---|
| 3457 | + | the committee, two of whom shall be members of a 168 |
|---|
| 3458 | + | statewide law enforcement association that 169 |
|---|
| 3459 | + | represents at least five thousand law 170 |
|---|
| 3460 | + | enforcement officers. The remaining members of 171 |
|---|
| 3461 | + | the committee shall include the police chief of 172 |
|---|
| 3462 | + | the municipal police force and a person who 173 |
|---|
| 3463 | + | currently or previously served as a commissioner 174 |
|---|
| 3464 | + | on the board of police commissioners, who shall 175 |
|---|
| 3465 | + | be appointed to the committee by the mayor of 176 |
|---|
| 3466 | + | such city.] 177 |
|---|
| 3467 | + | [84.345. 1. Except as required for the 1 |
|---|
| 3468 | + | board of police commissioners to conclude its 2 |
|---|
| 3469 | + | affairs and pursue legal claims and defenses, 3 |
|---|
| 3470 | + | upon the establishment of a municipal police 4 |
|---|
| 3471 | + | force, the terms of office of the commissioners 5 |
|---|
| 3472 | + | of the board of police created under sections 6 |
|---|
| 3473 | + | 84.020 and 84.030 shall expire, and the 7 |
|---|
| 3474 | + | provisions of sections 84.010 to 84.340 shall 8 |
|---|
| 3475 | + | not apply to any city not within a county or its 9 |
|---|
| 3476 | + | municipal police force as of such date. The 10 |
|---|
| 3477 | + | board shall continue to oper ate, if necessary, 11 |
|---|
| 3478 | + | to wind down the board's affairs until the 12 |
|---|
| 3479 | + | transfer of ownership and obligations under 13 |
|---|
| 3480 | + | subsection 2 of section 84.344 has been 14 |
|---|
| 3481 | + | completed. During such time, the board of 15 |
|---|
| 3482 | + | 102 |
|---|
| 3483 | + | police commissioners shall designate and 16 |
|---|
| 3484 | + | authorize its secret ary to act on behalf of the 17 |
|---|
| 3485 | + | board for purposes of performing the board's 18 |
|---|
| 3486 | + | duties and any other actions incident to the 19 |
|---|
| 3487 | + | transfer and winding down of the board's affairs. 20 |
|---|
| 3488 | + | 2. For any claim, lawsuit, or other action 21 |
|---|
| 3489 | + | arising out of actions occurring be fore the date 22 |
|---|
| 3490 | + | of completion of the transfer provided under 23 |
|---|
| 3491 | + | subsection 2 of section 84.344, the state shall 24 |
|---|
| 3492 | + | continue to provide legal representation as set 25 |
|---|
| 3493 | + | forth in section 105.726, and the state legal 26 |
|---|
| 3494 | + | expense fund shall continue to provide 27 |
|---|
| 3495 | + | reimbursement for such claims under section 28 |
|---|
| 3496 | + | 105.726. This subsection applies to all claims, 29 |
|---|
| 3497 | + | lawsuits, and other actions brought against any 30 |
|---|
| 3498 | + | commissioner, police officer, employee, agent, 31 |
|---|
| 3499 | + | representative, or any individual or entity 32 |
|---|
| 3500 | + | acting or purporting to act o n its or their 33 |
|---|
| 3501 | + | behalf. 34 |
|---|
| 3502 | + | 3. Notwithstanding any other provision of 35 |
|---|
| 3503 | + | law, rule, or regulation to the contrary, any 36 |
|---|
| 3504 | + | city not within a county that establishes a 37 |
|---|
| 3505 | + | municipal police force under sections 84.343 to 38 |
|---|
| 3506 | + | 84.346 shall not be restricted or limited in any 39 |
|---|
| 3507 | + | way in the selection of a police chief or chief 40 |
|---|
| 3508 | + | of the division created under subsection 8 of 41 |
|---|
| 3509 | + | section 84.344. 42 |
|---|
| 3510 | + | 4. It shall be the duty of the sheriff for 43 |
|---|
| 3511 | + | any city not within a county, whenever called 44 |
|---|
| 3512 | + | upon by the police chief of the municip al police 45 |
|---|
| 3513 | + | force, to act under the police chief's control 46 |
|---|
| 3514 | + | for the preservation of the public peace and 47 |
|---|
| 3515 | + | quiet; and, whenever the exigency or 48 |
|---|
| 3516 | + | circumstances may, in the police chief's 49 |
|---|
| 3517 | + | judgment, warrant it, said police chief shall 50 |
|---|
| 3518 | + | have the power to assume the control and command 51 |
|---|
| 3519 | + | of all local and municipal conservators of the 52 |
|---|
| 3520 | + | peace of the city, whether sheriff, constable, 53 |
|---|
| 3521 | + | policemen or others, and they shall act under 54 |
|---|
| 3522 | + | the orders of the said police chief and not 55 |
|---|
| 3523 | + | otherwise.] 56 |
|---|
| 3524 | + | [84.346. Any police pension system created 1 |
|---|
| 3525 | + | under chapter 86 for the benefit of a police 2 |
|---|
| 3526 | + | force established under sections 84.010 to 3 |
|---|
| 3527 | + | 84.340 shall continue to be governed by chapter 4 |
|---|
| 3528 | + | 103 |
|---|
| 3529 | + | 86, and shall apply to any police force 5 |
|---|
| 3530 | + | established under section 84.343 to 84.3 46. 6 |
|---|
| 3531 | + | Other than any provision that makes chapter 86 7 |
|---|
| 3532 | + | applicable to a municipal police force 8 |
|---|
| 3533 | + | established under section 84.343 to 84.346, 9 |
|---|
| 3534 | + | nothing in sections 84.343 to 84.346 shall be 10 |
|---|
| 3535 | + | construed as limiting or changing the rights or 11 |
|---|
| 3536 | + | benefits provided und er chapter 86.] 12 |
|---|
| 3537 | + | [84.347. Notwithstanding the provisions of 1 |
|---|
| 3538 | + | section 1.140 to the contrary, the provisions of 2 |
|---|
| 3539 | + | sections 84.343 to 84.346 shall be 3 |
|---|
| 3540 | + | nonseverable. If any provision of sections 4 |
|---|
| 3541 | + | 84.343 to 84.346 is for any reason held to be 5 |
|---|
| 3542 | + | invalid, such decision shall invalidate all of 6 |
|---|
| 3543 | + | the remaining provisions of this act. ] 7 |
|---|
| 3544 | + | [217.825. Sections 217.825 to 217.841 1 |
|---|
| 3545 | + | shall be known and may be cited as the "Missouri 2 |
|---|
| 3546 | + | Incarceration Reimbursement Act". ] 3 |
|---|
| 3547 | + | [217.827. As used in sections 217.825 to 1 |
|---|
| 3548 | + | 217.841, the following terms shall mean: 2 |
|---|
| 3549 | + | (1) (a) "Assets", property, tangible or 3 |
|---|
| 3550 | + | intangible, real or personal, belonging to or 4 |
|---|
| 3551 | + | due an offender or a former offender, including 5 |
|---|
| 3552 | + | income or payments to such offender from Social 6 |
|---|
| 3553 | + | Security, workers' compensation, veterans' 7 |
|---|
| 3554 | + | compensation, pension benefits, previously 8 |
|---|
| 3555 | + | earned salary or wages, bonuses, annuities, 9 |
|---|
| 3556 | + | retirement benefits, or from any other source 10 |
|---|
| 3557 | + | whatsoever, including any of the following: 11 |
|---|
| 3558 | + | a. Money or other tangible assets received 12 |
|---|
| 3559 | + | by the offender as a result of a settlement of a 13 |
|---|
| 3560 | + | claim against the state, any agency thereof, or 14 |
|---|
| 3561 | + | any claim against an employee or independent 15 |
|---|
| 3562 | + | contractor arising from and in the scope of said 16 |
|---|
| 3563 | + | employee's or contrac tor's official duties on 17 |
|---|
| 3564 | + | behalf of the state or any agency thereof; 18 |
|---|
| 3565 | + | b. A money judgment received by the 19 |
|---|
| 3566 | + | offender from the state as a result of a civil 20 |
|---|
| 3567 | + | action in which the state, an agency thereof or 21 |
|---|
| 3568 | + | any state employee or independent contractor 22 |
|---|
| 3569 | + | where such judgment arose from a claim arising 23 |
|---|
| 3570 | + | from the conduct of official duties on behalf of 24 |
|---|
| 3571 | + | the state by said employee or subcontractor or 25 |
|---|
| 3572 | + | for any agency of the state; 26 |
|---|
| 3573 | + | 104 |
|---|
| 3574 | + | c. A current stream of income from any 27 |
|---|
| 3575 | + | source whatsoever, including a salar y, wages, 28 |
|---|
| 3576 | + | disability, retirement, pension, insurance or 29 |
|---|
| 3577 | + | annuity benefits or similar payments; 30 |
|---|
| 3578 | + | (b) "Assets" shall not include: 31 |
|---|
| 3579 | + | a. The homestead of the offender up to 32 |
|---|
| 3580 | + | fifty thousand dollars in value; 33 |
|---|
| 3581 | + | b. Money saved by the offender from w ages 34 |
|---|
| 3582 | + | and bonuses up to two thousand five hundred 35 |
|---|
| 3583 | + | dollars paid the offender while he or she was 36 |
|---|
| 3584 | + | confined to a state correctional center; 37 |
|---|
| 3585 | + | (2) "Cost of care", the cost to the 38 |
|---|
| 3586 | + | department of corrections for providing 39 |
|---|
| 3587 | + | transportation, room, board, clot hing, security, 40 |
|---|
| 3588 | + | medical, and other normal living expenses of 41 |
|---|
| 3589 | + | offenders under the jurisdiction of the 42 |
|---|
| 3590 | + | department, as determined by the director of the 43 |
|---|
| 3591 | + | department; 44 |
|---|
| 3592 | + | (3) "Department", the department of 45 |
|---|
| 3593 | + | corrections of this state; 46 |
|---|
| 3594 | + | (4) "Director", the director of the 47 |
|---|
| 3595 | + | department; 48 |
|---|
| 3596 | + | (5) "Offender", any person who is under 49 |
|---|
| 3597 | + | the jurisdiction of the department and is 50 |
|---|
| 3598 | + | confined in any state correctional center or is 51 |
|---|
| 3599 | + | under the continuing jurisdiction of the 52 |
|---|
| 3600 | + | department; 53 |
|---|
| 3601 | + | (6) "State correctional center", a 54 |
|---|
| 3602 | + | facility or institution which houses an offender 55 |
|---|
| 3603 | + | population under the jurisdiction of the 56 |
|---|
| 3604 | + | department. State correctional center includes 57 |
|---|
| 3605 | + | a correctional camp, community correction 58 |
|---|
| 3606 | + | center, honor center, or state prison. ] 59 |
|---|
| 3607 | + | [217.829. 1. The department shall develop 1 |
|---|
| 3608 | + | a form which shall be used by the department to 2 |
|---|
| 3609 | + | obtain information from all offenders regarding 3 |
|---|
| 3610 | + | their assets. 4 |
|---|
| 3611 | + | 2. The form shall be submitted to each 5 |
|---|
| 3612 | + | offender as of the date the form is developed 6 |
|---|
| 3613 | + | and to every offender who thereafter is 7 |
|---|
| 3614 | + | sentenced to imprisonment under the jurisdiction 8 |
|---|
| 3615 | + | of the department. The form may be resubmitted 9 |
|---|
| 3616 | + | to an offender by the department for purposes of 10 |
|---|
| 3617 | + | obtaining current information regarding assets 11 |
|---|
| 3618 | + | of the offender. 12 |
|---|
| 3619 | + | 105 |
|---|
| 3620 | + | 3. Every offender shall complete the form 13 |
|---|
| 3621 | + | or provide for completion of the form and the 14 |
|---|
| 3622 | + | offender shall swear or affirm under oath that 15 |
|---|
| 3623 | + | to the best of his or her knowledge the 16 |
|---|
| 3624 | + | information provided is complete and accurate. 17 |
|---|
| 3625 | + | Any person who shall knowi ngly provide false 18 |
|---|
| 3626 | + | information on said form to state officials or 19 |
|---|
| 3627 | + | employees shall be guilty of the crime of making 20 |
|---|
| 3628 | + | a false affidavit as provided by section 575.050. 21 |
|---|
| 3629 | + | 4. Failure by an offender to fully, 22 |
|---|
| 3630 | + | adequately and correctly complete the form ma y 23 |
|---|
| 3631 | + | be considered by the parole board for purposes 24 |
|---|
| 3632 | + | of a parole determination, and in determining an 25 |
|---|
| 3633 | + | offender's parole release date or eligibility 26 |
|---|
| 3634 | + | and shall constitute sufficient grounds for 27 |
|---|
| 3635 | + | denial of parole. 28 |
|---|
| 3636 | + | 5. Prior to release of any offender fro m 29 |
|---|
| 3637 | + | imprisonment, and again prior to release from 30 |
|---|
| 3638 | + | the jurisdiction of the department, the 31 |
|---|
| 3639 | + | department shall request from the offender an 32 |
|---|
| 3640 | + | assignment of ten percent of any wages, salary, 33 |
|---|
| 3641 | + | benefits or payments from any source. Such an 34 |
|---|
| 3642 | + | assignment shall be v alid for the longer period 35 |
|---|
| 3643 | + | of five years from the date of its execution, or 36 |
|---|
| 3644 | + | five years from the date that the offender is 37 |
|---|
| 3645 | + | released from the jurisdiction of the department 38 |
|---|
| 3646 | + | or any of its divisions or agencies. The 39 |
|---|
| 3647 | + | assignment shall secure payment of the total 40 |
|---|
| 3648 | + | cost of care of the offender executing the 41 |
|---|
| 3649 | + | assignment. The restrictions on the maximum 42 |
|---|
| 3650 | + | amount of earnings subject to garnishment 43 |
|---|
| 3651 | + | contained in section 525.030 shall apply to 44 |
|---|
| 3652 | + | earnings subject to assignments executed 45 |
|---|
| 3653 | + | pursuant to this subsection. ] 46 |
|---|
| 3654 | + | [217.831. 1. The director shall forward 1 |
|---|
| 3655 | + | to the attorney general a report on each 2 |
|---|
| 3656 | + | offender containing a completed form pursuant to 3 |
|---|
| 3657 | + | the provisions of section 217.829 together with 4 |
|---|
| 3658 | + | all other information available on the assets of 5 |
|---|
| 3659 | + | the offender and an estimate of the total cost 6 |
|---|
| 3660 | + | of care for that offender. 7 |
|---|
| 3661 | + | 2. The attorney general may investigate or 8 |
|---|
| 3662 | + | cause to be investigated all reports furnished 9 |
|---|
| 3663 | + | pursuant to the provisions of subsection 1 of 10 |
|---|
| 3664 | + | this section. This investigation m ay include 11 |
|---|
| 3665 | + | 106 |
|---|
| 3666 | + | seeking information from any source that may 12 |
|---|
| 3667 | + | have relevant information concerning an 13 |
|---|
| 3668 | + | offender's assets. The director shall provide 14 |
|---|
| 3669 | + | all information possessed by the department and 15 |
|---|
| 3670 | + | its divisions and agencies, upon request of the 16 |
|---|
| 3671 | + | attorney general, in order to assist the 17 |
|---|
| 3672 | + | attorney general in completing his duties 18 |
|---|
| 3673 | + | pursuant to sections 217.825 to 217.841. 19 |
|---|
| 3674 | + | 3. If the attorney general upon completing 20 |
|---|
| 3675 | + | the investigation under subsection 2 of this 21 |
|---|
| 3676 | + | section has good cause to believe that an 22 |
|---|
| 3677 | + | offender or former offender has sufficient 23 |
|---|
| 3678 | + | assets to recover not less than ten percent of 24 |
|---|
| 3679 | + | the estimated cost of care of the offender or 25 |
|---|
| 3680 | + | ten percent of the estimated cost of care of the 26 |
|---|
| 3681 | + | offender for two years, whichever is less, or 27 |
|---|
| 3682 | + | has a stream of income sufficient to pay such 28 |
|---|
| 3683 | + | amounts within a five -year period, the attorney 29 |
|---|
| 3684 | + | general may seek to secure reimbursement for the 30 |
|---|
| 3685 | + | expense of the state of Missouri for the cost of 31 |
|---|
| 3686 | + | care of such offender or former offender. 32 |
|---|
| 3687 | + | 4. The attorney general, or any 33 |
|---|
| 3688 | + | prosecuting attorney on behalf of the attorney 34 |
|---|
| 3689 | + | general, shall not bring an action pursuant to 35 |
|---|
| 3690 | + | this section against an offender or former 36 |
|---|
| 3691 | + | offender after the expiration of five years 37 |
|---|
| 3692 | + | after his release from the jurisdiction of the 38 |
|---|
| 3693 | + | department.] 39 |
|---|
| 3694 | + | [217.833. 1. Not more than ninety percent 1 |
|---|
| 3695 | + | of the value of the assets of the offender may 2 |
|---|
| 3696 | + | be used for purposes of securing costs and 3 |
|---|
| 3697 | + | reimbursement pursuant to the provisions of 4 |
|---|
| 3698 | + | sections 217.825 to 217.841. 5 |
|---|
| 3699 | + | 2. The amount of reimbursement sought from 6 |
|---|
| 3700 | + | an offender shall not be in excess of the per 7 |
|---|
| 3701 | + | capita cost for care for maintaining offenders 8 |
|---|
| 3702 | + | in the state correctional center in which the 9 |
|---|
| 3703 | + | offender is housed for the period or periods 10 |
|---|
| 3704 | + | such offender is an offender in a state 11 |
|---|
| 3705 | + | correctional center. ] 12 |
|---|
| 3706 | + | [217.835. 1. The circuit court shall have 1 |
|---|
| 3707 | + | exclusive jurisdiction over all proceedings 2 |
|---|
| 3708 | + | seeking reimbursement from offenders pursuant to 3 |
|---|
| 3709 | + | the provisions of sections 217.825 to 217.841. 4 |
|---|
| 3710 | + | The attorney general may file a complaint in the 5 |
|---|
| 3711 | + | 107 |
|---|
| 3712 | + | circuit court for the county or city from which 6 |
|---|
| 3713 | + | a prisoner was sentenced or in the circuit court 7 |
|---|
| 3714 | + | in the county or city of the office of the 8 |
|---|
| 3715 | + | director of the department, against any person 9 |
|---|
| 3716 | + | under the jurisdiction of the departmen t stating 10 |
|---|
| 3717 | + | that the person is or has been an offender in a 11 |
|---|
| 3718 | + | state correctional center, that there is good 12 |
|---|
| 3719 | + | cause to believe that the person has assets, and 13 |
|---|
| 3720 | + | praying that the assets be used to reimburse the 14 |
|---|
| 3721 | + | state for the expenses incurred or to be 15 |
|---|
| 3722 | + | incurred, or both, by the state for the cost of 16 |
|---|
| 3723 | + | care of the person as an offender. 17 |
|---|
| 3724 | + | 2. Upon the filing of the complaint under 18 |
|---|
| 3725 | + | subsection 1 of this section, the court shall 19 |
|---|
| 3726 | + | issue an order to show cause why the prayer of 20 |
|---|
| 3727 | + | the complainant should not be grant ed. The 21 |
|---|
| 3728 | + | complaint and order shall be served upon the 22 |
|---|
| 3729 | + | person personally, or, if the person is confined 23 |
|---|
| 3730 | + | in a state correctional center, by registered 24 |
|---|
| 3731 | + | mail addressed to the person in care of the 25 |
|---|
| 3732 | + | chief administrator of the state correctional 26 |
|---|
| 3733 | + | center where the person is housed, at least 27 |
|---|
| 3734 | + | thirty days before the date of hearing on the 28 |
|---|
| 3735 | + | complaint and order. 29 |
|---|
| 3736 | + | 3. At the time of the hearing on the 30 |
|---|
| 3737 | + | complaint and order, if it appears that the 31 |
|---|
| 3738 | + | person has any assets which ought to be 32 |
|---|
| 3739 | + | subjected to the claim o f the state pursuant to 33 |
|---|
| 3740 | + | the provisions of sections 217.825 to 217.841, 34 |
|---|
| 3741 | + | the court shall issue an order requiring any 35 |
|---|
| 3742 | + | person, corporation, or other legal entity 36 |
|---|
| 3743 | + | possessed or having custody of such assets, to 37 |
|---|
| 3744 | + | appropriate and apply such assets or a portio n 38 |
|---|
| 3745 | + | thereof to satisfy such claim. 39 |
|---|
| 3746 | + | 4. At the hearing on the complaint and 40 |
|---|
| 3747 | + | order and before entering any order on behalf of 41 |
|---|
| 3748 | + | the state against the defendant, the court shall 42 |
|---|
| 3749 | + | take into consideration any legal obligation of 43 |
|---|
| 3750 | + | the defendant to support a spouse, minor 44 |
|---|
| 3751 | + | children, or other dependents and any moral 45 |
|---|
| 3752 | + | obligation to support dependents to whom the 46 |
|---|
| 3753 | + | defendant is providing or has in fact provided 47 |
|---|
| 3754 | + | support. 48 |
|---|
| 3755 | + | 5. If the person, corporation, or other 49 |
|---|
| 3756 | + | legal entity shall neglect or refuse to comply 50 |
|---|
| 3757 | + | with an order issued pursuant to subsection 3 of 51 |
|---|
| 3758 | + | 108 |
|---|
| 3759 | + | this section, the court shall order the person, 52 |
|---|
| 3760 | + | corporation, or other legal entity to appear 53 |
|---|
| 3761 | + | before the court at such time as the court may 54 |
|---|
| 3762 | + | direct and to show cause why the person, 55 |
|---|
| 3763 | + | corporation, or other legal entity should not be 56 |
|---|
| 3764 | + | considered in contempt of court. 57 |
|---|
| 3765 | + | 6. If, in the opinion of the court, the 58 |
|---|
| 3766 | + | assets of the prisoner are sufficient to pay the 59 |
|---|
| 3767 | + | cost of the proceedings undertaken pursuant to 60 |
|---|
| 3768 | + | the provisions of sections 217.825 to 217.841, 61 |
|---|
| 3769 | + | the prisoner shall be liable for those costs 62 |
|---|
| 3770 | + | upon order of the court. ] 63 |
|---|
| 3771 | + | [217.837. 1. Except as provided in 1 |
|---|
| 3772 | + | subsection 3 of this section, the attorney 2 |
|---|
| 3773 | + | general may use any remedy, interim order, or 3 |
|---|
| 3774 | + | enforcement procedure allowed by law or court 4 |
|---|
| 3775 | + | rule including an ex parte restraining order to 5 |
|---|
| 3776 | + | restrain the prisoner or any other person or 6 |
|---|
| 3777 | + | legal entity in possession or having custody of 7 |
|---|
| 3778 | + | the estate of the prisoner from disposing of 8 |
|---|
| 3779 | + | certain property in avoidance of an order issued 9 |
|---|
| 3780 | + | pursuant to the provisions of section 217.835. 10 |
|---|
| 3781 | + | 2. To protect and maintain assets pending 11 |
|---|
| 3782 | + | resolution of proceedings initiated pursuant to 12 |
|---|
| 3783 | + | the provisions of section 217.835, the court, 13 |
|---|
| 3784 | + | upon request, may appoint a receiver. 14 |
|---|
| 3785 | + | 3. The attorney general or a prosecuting 15 |
|---|
| 3786 | + | attorney shall not enforce any judgment obtained 16 |
|---|
| 3787 | + | pursuant to the provisions of section 217.835 by 17 |
|---|
| 3788 | + | means of execution against the homestead of the 18 |
|---|
| 3789 | + | prisoner. 19 |
|---|
| 3790 | + | 4. The state's right to recover the cost 20 |
|---|
| 3791 | + | of incarceration pursuant to an order issued 21 |
|---|
| 3792 | + | pursuant to the provisions of section 217.835 22 |
|---|
| 3793 | + | shall have priority over all other liens, debts, 23 |
|---|
| 3794 | + | or other incumbrances against real property or 24 |
|---|
| 3795 | + | any other assets which are part of a prisoner's 25 |
|---|
| 3796 | + | estate.] 26 |
|---|
| 3797 | + | [217.839. 1. The attorney general of this 1 |
|---|
| 3798 | + | state shall enforce the provisions of sections 2 |
|---|
| 3799 | + | 217.825 to 217.841, except that the attorney 3 |
|---|
| 3800 | + | general may request the prosecuting attorney of 4 |
|---|
| 3801 | + | the county or city in which the offender was 5 |
|---|
| 3802 | + | sentenced or the prosecuting attorney of the 6 |
|---|
| 3803 | + | county or city in which any asset of an offender 7 |
|---|
| 3804 | + | 109 |
|---|
| 3805 | + | is located to make an investigation or assist in 8 |
|---|
| 3806 | + | legal proceedings undertaken pursuant to the 9 |
|---|
| 3807 | + | provisions of sections 217.825 to 217.841. 10 |
|---|
| 3808 | + | 2. The sentencing judge, the sheriff, the 11 |
|---|
| 3809 | + | county or city, the chief administrator of the 12 |
|---|
| 3810 | + | state correctional center, and the state 13 |
|---|
| 3811 | + | treasurer shall furnish to the attorney general 14 |
|---|
| 3812 | + | or prosecuting attorney all information and 15 |
|---|
| 3813 | + | assistance possible to enable the attorney 16 |
|---|
| 3814 | + | general or prosecuting attorney to se cure 17 |
|---|
| 3815 | + | reimbursement for the state pursuant to the 18 |
|---|
| 3816 | + | provisions of sections 217.825 to 217.841. 19 |
|---|
| 3817 | + | 3. Notwithstanding the provisions of any 20 |
|---|
| 3818 | + | other law protecting the confidentiality of any 21 |
|---|
| 3819 | + | information possessed by the state, its 22 |
|---|
| 3820 | + | officials and agencies, the secretary of state, 23 |
|---|
| 3821 | + | the director of the department of revenue, the 24 |
|---|
| 3822 | + | director of the department of social services, 25 |
|---|
| 3823 | + | the director of the department of corrections, 26 |
|---|
| 3824 | + | the director of the department of labor and 27 |
|---|
| 3825 | + | industrial relations, the director of the 28 |
|---|
| 3826 | + | department of public safety, and the 29 |
|---|
| 3827 | + | commissioner of administration, and each 30 |
|---|
| 3828 | + | division or agency within or assigned to such 31 |
|---|
| 3829 | + | departments, shall provide the attorney general 32 |
|---|
| 3830 | + | or prosecuting attorney with all information 33 |
|---|
| 3831 | + | requested pursuant to the provisi ons of sections 34 |
|---|
| 3832 | + | 217.825 to 217.841. 35 |
|---|
| 3833 | + | 4. Any county or municipal official having 36 |
|---|
| 3834 | + | custody of records of the estate or real 37 |
|---|
| 3835 | + | property of any offender or former offender 38 |
|---|
| 3836 | + | shall surrender said records or certified copies 39 |
|---|
| 3837 | + | thereof without fee to the attor ney general or 40 |
|---|
| 3838 | + | prosecuting attorney who request such records 41 |
|---|
| 3839 | + | pursuant to the provisions of sections 217.825 42 |
|---|
| 3840 | + | to 217.841.] 43 |
|---|
| 3841 | + | [217.841. 1. The costs of any 1 |
|---|
| 3842 | + | investigations shall be paid from the 2 |
|---|
| 3843 | + | reimbursements secured pursuant to the 3 |
|---|
| 3844 | + | provisions of sections 217.825 to 217.841. The 4 |
|---|
| 3845 | + | investigative costs shall be presumed to be 5 |
|---|
| 3846 | + | twenty percent of the reimbursements recovered, 6 |
|---|
| 3847 | + | unless the attorney general shall demonstrate to 7 |
|---|
| 3848 | + | the court otherwise. All reimbursements 8 |
|---|
| 3849 | + | collected shall be p aid to the "Inmate 9 |
|---|
| 3850 | + | 110 |
|---|
| 3851 | + | Incarceration Reimbursement Act Revolving Fund", 10 |
|---|
| 3852 | + | which is hereby established in the state 11 |
|---|
| 3853 | + | treasury. Moneys in the inmate incarceration 12 |
|---|
| 3854 | + | reimbursement act revolving fund shall be 13 |
|---|
| 3855 | + | appropriated to the attorney general in order to 14 |
|---|
| 3856 | + | defray the costs of the attorney general in 15 |
|---|
| 3857 | + | connection with his duties provided by sections 16 |
|---|
| 3858 | + | 217.825 to 217.841; and all remaining balances 17 |
|---|
| 3859 | + | shall be appropriated to the department for 18 |
|---|
| 3860 | + | purposes of construction and operation of state 19 |
|---|
| 3861 | + | correctional facilities. The provisions of 20 |
|---|
| 3862 | + | section 33.080 notwithstanding, moneys in the 21 |
|---|
| 3863 | + | inmate incarceration reimbursement act revolving 22 |
|---|
| 3864 | + | fund shall not lapse, be transferred or 23 |
|---|
| 3865 | + | appropriated to or placed to the credit of the 24 |
|---|
| 3866 | + | general revenue fund or any other fund of the 25 |
|---|
| 3867 | + | state. 26 |
|---|
| 3868 | + | 2. The state treasurer may determine the 27 |
|---|
| 3869 | + | amount due the state for the cost of care of an 28 |
|---|
| 3870 | + | offender and render statements thereof and such 29 |
|---|
| 3871 | + | sworn statements shall be considered prima facie 30 |
|---|
| 3872 | + | evidence of the amount due. ] 31 |
|---|
| 3873 | + | [574.050. 1. A person commits the offense 1 |
|---|
| 3874 | + | of rioting if he or she knowingly assembles with 2 |
|---|
| 3875 | + | six or more other persons and agrees with such 3 |
|---|
| 3876 | + | persons to violate any of the criminal laws of 4 |
|---|
| 3877 | + | this state or of the United States with force or 5 |
|---|
| 3878 | + | violence, and therea fter, while still so 6 |
|---|
| 3879 | + | assembled, does violate any of said laws with 7 |
|---|
| 3880 | + | force or violence. 8 |
|---|
| 3881 | + | 2. The offense of rioting is a class A 9 |
|---|
| 3882 | + | misdemeanor.] 10 |
|---|
| 3883 | + | Section B. In order to ensure the continued operation 1 |
|---|
| 3884 | + | of a police force in the city o f St. Louis for the safety 2 |
|---|
| 3885 | + | and well being of the citizens of the city of St. Louis, the 3 |
|---|
| 3886 | + | repeal of sections 84.175, 84.240, 84.341, 84.342, 84.343, 4 |
|---|
| 3887 | + | 84.344, 84.345, 84.346, and 84.347, the repeal and 5 |
|---|
| 3888 | + | reenactment of sections 84.020, 84.030, 84.100, 84.150 , 6 |
|---|
| 3889 | + | 84.160, 84.170 and 105.726, and the enactment of sections 7 |
|---|
| 3890 | + | 84.225 and 84.325 of this act is deemed necessary for the 8 |
|---|
| 3891 | + | immediate preservation of the public health, welfare, peace, 9 |
|---|
| 3892 | + | 111 |
|---|
| 3893 | + | and safety, and is hereby declared to be an emergency act 10 |
|---|
| 3894 | + | within the meaning of the constitution, and the repeal of 11 |
|---|
| 3895 | + | sections 84.175, 84.240, 84.341, 84.342, 84.343, 84.344, 12 |
|---|
| 3896 | + | 84.345, 84.346, and 84.347, the repeal and reenactment of 13 |
|---|
| 3897 | + | sections 84.020, 84.030, 84.100, 84.150, 84.160, 84.170 and 14 |
|---|
| 3898 | + | 105.726, and the enactment of sec tions 84.225 and 84.325 of 15 |
|---|
| 3899 | + | this act shall be in full force and effect upon its passage 16 |
|---|
| 3900 | + | and approval. 17 |
|---|